Glyma06g43670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g43670

Feature Type:	gene_model
Chromosome:	Gm06
Start:	46692735
stop:	46693853
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g43670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23650	AT	Annotation by Michelle Graham. TAIR10: calcium-dependent protein kinase 6 \| chr4:12324967-12327415 REVERSE LENGTH=529	SoyBase	E_val: 4.00E-33	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010119	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement	SoyBase	N/A	ISS
GO:0010359	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity	SoyBase	N/A	ISS
GO:0032880	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein localization	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0051049	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004683	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin-dependent protein kinase activity	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24349	Panther	SERINE/THREONINE-PROTEIN KINASE	JGI		ISS
PTHR24349:SF13	Panther		JGI		ISS
UniRef100_G7KAQ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Calcium dependent protein kinase n=1 Tax=Medicago truncatula RepID=G7KAQ8_MEDTR	SoyBase	E_val: 2.00E-32	ISS
UniRef100_I1JAA6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JAA6_SOYBN	SoyBase	E_val: 1.00E-34	ISS

Expression Patterns of Glyma06g43670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g43670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g43670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g43670

Limit To All Plant Sequences

>Glyma06g43670.1   sequence type=CDS   gene model=Glyma06g43670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCATCCGATAAACCTTGATCTAGATGTTGTTGTTTTATCTAGAATGAAACAATTTAGGGCAATGAACAAGCTAAAAAAAGTTGCTTTGAAGGTTATTGCTGAAAACCTTTCTGAAGAAGAAATCATTGGTTTGAAGGAAATGTTTAAATCCATGGACACAGATAACACTGGTTTGCCAAAACTGGGTACTAAGGTTTCTGAGTCTGAAGTAAGGCAATTGATGGAAGCGGTAAGAATTTTGTCTGATTATACTTCAGCCTTTTTGAACACCGTCAGAATTATGATTCAAGGTGCAAACCTAAAAAACATGACTTGTTATGAGAGACTATCATATAAATAA

Predicted protein sequences of Glyma06g43670

Limit To All Plant Sequences

>Glyma06g43670.1   sequence type=predicted peptide   gene model=Glyma06g43670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEHPINLDLDVVVLSRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNTGLPKLGTKVSESEVRQLMEAVRILSDYTSAFLNTVRIMIQGANLKNMTCYERLSYK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain