Glyma06g43070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g43070

Feature Type:	gene_model
Chromosome:	Gm06
Start:	46422004
stop:	46422432
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g43070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G06340	AT	Annotation by Michelle Graham. TAIR10: Plant Tudor-like protein \| chr1:1933583-1933987 REVERSE LENGTH=134	SoyBase	E_val: 3.00E-36	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
PF05641	PFAM	Agenet domain	JGI		ISS
UniRef100_D7KG24	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Agenet domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KG24_ARALL	SoyBase	E_val: 4.00E-33	ISS
UniRef100_I1KEN6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEN6_SOYBN	SoyBase	E_val: 3.00E-102	ISS

Expression Patterns of Glyma06g43070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g43070

Paralog	Evidence	Comments
Glyma12g15170	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g43070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g277700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g43070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g43070

Limit To All Plant Sequences

>Glyma06g43070.1   sequence type=CDS   gene model=Glyma06g43070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGTCCACCGCGTAAGAGGGTGGATTTCGCGCGCGACGACAAGGTGGAGATCTGCGGCAACGAGGATGGCTTCCTCGGCTCCTACTACCAAGCCACGGTCGTGTCGCGCCTCGACAACGGCCTCTACGTCGTACGCTACGACACGCTCCTCGAAGACGACGCATCACAACAACCCCTTACCGAAACCCTTTTCCCCAAAGAACTCCGTCCCCAGCCGCCACGTGTCTCCAAAACCGATTTCGCGCTCTACCAGTGCGTCGACGCCTTCGACAACGACGGCTGGTGGCTCGGCCAGGTCACCGGAAAAAAAGACGCCGAGCATTACTACGTGTATTTTTCTACCACTAATGAGGAGATTGCGTATCATGTTTCTGCGATTAGGGTTCATCATGAGTGGAGCCATGGGGAGTGGGTTTTGTCCAATTGA

Predicted protein sequences of Glyma06g43070

Limit To All Plant Sequences

>Glyma06g43070.1   sequence type=predicted peptide   gene model=Glyma06g43070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRPPRKRVDFARDDKVEICGNEDGFLGSYYQATVVSRLDNGLYVVRYDTLLEDDASQQPLTETLFPKELRPQPPRVSKTDFALYQCVDAFDNDGWWLGQVTGKKDAEHYYVYFSTTNEEIAYHVSAIRVHHEWSHGEWVLSN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain