SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g42900

Feature Type:gene_model
Chromosome:Gm06
Start:46208742
stop:46211518
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42680AT Annotation by Michelle Graham. TAIR10: multiprotein bridging factor 1A | chr2:17774972-17776116 FORWARD LENGTH=142 SoyBaseE_val: 6.00E-85ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003713GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription coactivator activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG3398 KOG Transcription factor MBF1 JGI ISS
PTHR10245Panther ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1 (MULTIPROTEIN BRIDGING FACTOR 1) JGI ISS
PF01381PFAM Helix-turn-helix JGI ISS
PF08523PFAM Multiprotein bridging factor 1 JGI ISS
UniRef100_D7LJB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATMBF1A/MBF1A n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LJB8_ARALL SoyBaseE_val: 2.00E-84ISS
UniRef100_I1KEM1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEM1_SOYBN SoyBaseE_val: 2.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g15421 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g276300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g42900.1   sequence type=CDS   gene model=Glyma06g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGGTGTTGGCCCTCTTTCTCAAGATTGGGAACCCGTCGTCCTCCGCAAGAAGGCTCCCACTGCCGCCGCCAAGAAGGATGAGAAAGCCGTCAACGCCGCCCGCCGCTCCGGCGCCGAAATCGAAACCCTAAAAAAATATAATGCTGGGACAAATAAAGCAGCATCTAGCAGCACTTCATTGAACACTAAGAGGCTGGATGATGATACTGAGAGTCTAGCTCATGAGAAGGTACCAACTGAACTTAAGAAGGCCATAATGCAAGCTAGGATGGACAAGAAACTTACTCAGTCTCAGCTTGCTCAACTGATCAATGAGAAGCCTCAAGTGATCCAGGAGTACGAGTCAGGAAAGGCCATTCCAAACCAGCAGATAATTGGCAAGTTGGAAAGAGCCCTTGGAGCTAAATTGCGTGGCAAGAAATAA

>Glyma06g42900.1   sequence type=predicted peptide   gene model=Glyma06g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGVGPLSQDWEPVVLRKKAPTAAAKKDEKAVNAARRSGAEIETLKKYNAGTNKAASSSTSLNTKRLDDDTESLAHEKVPTELKKAIMQARMDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQIIGKLERALGAKLRGKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo