Glyma06g42900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g42900

Feature Type:	gene_model
Chromosome:	Gm06
Start:	46208742
stop:	46211518
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G42680	AT	Annotation by Michelle Graham. TAIR10: multiprotein bridging factor 1A \| chr2:17774972-17776116 FORWARD LENGTH=142	SoyBase	E_val: 6.00E-85	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transcription coactivator activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG3398	KOG	Transcription factor MBF1	JGI		ISS
PTHR10245	Panther	ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1 (MULTIPROTEIN BRIDGING FACTOR 1)	JGI		ISS
PF01381	PFAM	Helix-turn-helix	JGI		ISS
PF08523	PFAM	Multiprotein bridging factor 1	JGI		ISS
UniRef100_D7LJB8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATMBF1A/MBF1A n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LJB8_ARALL	SoyBase	E_val: 2.00E-84	ISS
UniRef100_I1KEM1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEM1_SOYBN	SoyBase	E_val: 2.00E-96	ISS

Expression Patterns of Glyma06g42900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g42900

Paralog	Evidence	Comments
Glyma12g15421	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g42900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g276300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42900

Limit To All Plant Sequences

>Glyma06g42900.1   sequence type=CDS   gene model=Glyma06g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGGTGTTGGCCCTCTTTCTCAAGATTGGGAACCCGTCGTCCTCCGCAAGAAGGCTCCCACTGCCGCCGCCAAGAAGGATGAGAAAGCCGTCAACGCCGCCCGCCGCTCCGGCGCCGAAATCGAAACCCTAAAAAAATATAATGCTGGGACAAATAAAGCAGCATCTAGCAGCACTTCATTGAACACTAAGAGGCTGGATGATGATACTGAGAGTCTAGCTCATGAGAAGGTACCAACTGAACTTAAGAAGGCCATAATGCAAGCTAGGATGGACAAGAAACTTACTCAGTCTCAGCTTGCTCAACTGATCAATGAGAAGCCTCAAGTGATCCAGGAGTACGAGTCAGGAAAGGCCATTCCAAACCAGCAGATAATTGGCAAGTTGGAAAGAGCCCTTGGAGCTAAATTGCGTGGCAAGAAATAA

Predicted protein sequences of Glyma06g42900

Limit To All Plant Sequences

>Glyma06g42900.1   sequence type=predicted peptide   gene model=Glyma06g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGVGPLSQDWEPVVLRKKAPTAAAKKDEKAVNAARRSGAEIETLKKYNAGTNKAASSSTSLNTKRLDDDTESLAHEKVPTELKKAIMQARMDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQIIGKLERALGAKLRGKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain