SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42890

Feature Type:gene_model
Chromosome:Gm06
Start:46196117
stop:46199021
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42680AT Annotation by Michelle Graham. TAIR10: multiprotein bridging factor 1A | chr2:17774972-17776116 FORWARD LENGTH=142 SoyBaseE_val: 1.00E-86ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003713GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription coactivator activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG3398 KOG Transcription factor MBF1 JGI ISS
PTHR10245Panther ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1 (MULTIPROTEIN BRIDGING FACTOR 1) JGI ISS
PF01381PFAM Helix-turn-helix JGI ISS
PF08523PFAM Multiprotein bridging factor 1 JGI ISS
UniRef100_C6SXJ2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXJ2_SOYBN SoyBaseE_val: 2.00E-96ISS
UniRef100_D7LJB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATMBF1A/MBF1A n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LJB8_ARALL SoyBaseE_val: 3.00E-86ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42890 not represented in the dataset

Glyma06g42890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g276200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g42890.1   sequence type=CDS   gene model=Glyma06g42890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGTGTTGGCCCTCTTTCTCAGGATTGGGAACCTGTCGTCCTCCGCAAGAAGGCTCCCACCGCCGCCGCCAAGAAGGACGAGAAAGCCGTCAACGCCGCCCGCCGCTCTGGCGCCGAAATCGAAACCCTAAAAAAGTATAATGCTGGGACAAACAAAGCAGCATCTAGCGGCACTTCATTGAACACTAAGAGGCTGGATGATGATACTGAGAGTCTAGCTCATGAGAAGGTGCCAACTGAACTTAAGAAGGCTATAATGCAAGCTAGGATGGACAAAAAGCTTACTCAGTCTCAGCTTGCTCAACTGATCAATGAGAAGCCTCAAGTGATCCAGGAGTATGAGTCAGGGAAGGCCATTCCAAACCAGCAGATAATTAGCAAGTTGGAAAGAGCTCTTGGAGCTAAACTGCGTGGCAAGAAATAA

>Glyma06g42890.1   sequence type=predicted peptide   gene model=Glyma06g42890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGVGPLSQDWEPVVLRKKAPTAAAKKDEKAVNAARRSGAEIETLKKYNAGTNKAASSGTSLNTKRLDDDTESLAHEKVPTELKKAIMQARMDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQIISKLERALGAKLRGKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo