SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g42810

Feature Type:gene_model
Chromosome:Gm06
Start:46110640
stop:46111371
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g42810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42760AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1685 (InterPro:IPR012881); Has 170 Blast hits to 164 proteins in 34 species: Archae - 0; Bacteria - 1; Metazoa - 26; Fungi - 10; Plants - 107; Viruses - 0; Other Eukaryotes - 26 (source: NCBI BLink). | chr2:17796382-17797185 REVERSE LENGTH=267 SoyBaseE_val: 8.00E-32ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF07939PFAM Protein of unknown function (DUF1685) JGI ISS
UniRef100_I1KEL4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEL4_SOYBN SoyBaseE_val: 1.00E-177ISS

Expression Patterns of Glyma06g42810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g42810
ParalogEvidenceComments
Glyma12g15530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g42810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g275500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g42810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g42810
>Glyma06g42810.1   sequence type=CDS   gene model=Glyma06g42810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCAGAACATGTTCTGAGGTTGCTAGATTCCTTCTGGTTTGAGGCTTCAATTCTCTCTAACAAAACCCTTTCAAATTCAATCTCTCATGATCACAATAAGGTGGTGGAGGAAGTGCTTCCTCTTGATGATGCAAAGCTTCTACTAGTTCCAACTCCTACCCTTGAAGTTAGGTCCTATAGTGACCAAAACTTGGACTCCACAACATGTCTTTTGTGTGATTATTCCCAATCACCAAATTCTGTGCTCACCCCACAAAGGCTTAGGACAATCCCTTCTGAGAGGGAAATCAGAGAATTCTCTAGTGGAAATCATGGAAAAGAAGGGATGAGCATTAAGAGAAAACAAAAAAGCTTTGGTCATGGAAGAAGGGCAAGGAAAGTGAGAACCAGCAGGAGCCTATCAGAGCTTGAGTTTAAGGAGCTAAAAGGGTTTATGGATTTGGGGTTTGTGTTCTCTGAGGAGGACAAGGACTCAAAATTGGCCTCTTTGATACCTGGCTTGCAGAGACTGGGAAGAGAAGAAGATGAAGAAGGGCAGGGTGATGATCAAAGTGTGGTTTCTGATAATAATAATAAGCCTTATTTGTCTGAGGCTTGGGATGTTTTGGACCAAAGGGAGATGGGAAATCCTTTGTTGAATTGGAGGGTACCAGCTAGGGGTAATGAAATTGACATGAAAGACAATCTTAGGTTCTGGGCTCACACTGTGGCATCCATTGTAAGATAA
Predicted protein sequences of Glyma06g42810
>Glyma06g42810.1   sequence type=predicted peptide   gene model=Glyma06g42810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAEHVLRLLDSFWFEASILSNKTLSNSISHDHNKVVEEVLPLDDAKLLLVPTPTLEVRSYSDQNLDSTTCLLCDYSQSPNSVLTPQRLRTIPSEREIREFSSGNHGKEGMSIKRKQKSFGHGRRARKVRTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRLGREEDEEGQGDDQSVVSDNNNKPYLSEAWDVLDQREMGNPLLNWRVPARGNEIDMKDNLRFWAHTVASIVR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo