Glyma06g42460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42460

Feature Type:	gene_model
Chromosome:	Gm06
Start:	45795913
stop:	45798376
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G45775	AT	Annotation by Michelle Graham. TAIR10: Ribosomal L5P family protein \| chr5:18565281-18566496 REVERSE LENGTH=182	SoyBase	E_val: 4.00E-126	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0397	KOG	60S ribosomal protein L11	JGI		ISS
PTHR11994	Panther	60S RIBOSOMAL PROTEIN L11-RELATED	JGI		ISS
PF00281	PFAM	Ribosomal protein L5	JGI		ISS
PF00673	PFAM	ribosomal L5P family C-terminus	JGI		ISS
UniRef100_C6SX50	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX50_SOYBN	SoyBase	E_val: 2.00E-129	ISS
UniRef100_P46287	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L11 n=1 Tax=Medicago sativa RepID=RL11_MEDSA	SoyBase	E_val: 9.00E-128	ISS

Expression Patterns of Glyma06g42460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42460 not represented in the dataset	Glyma06g42460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g42460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g272500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42460

Limit To All Plant Sequences

>Glyma06g42460.1   sequence type=CDS   gene model=Glyma06g42460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAGAGAAGAAACTTTCGAACCCAATGAGGGAGATAAAGGTGCAGAAGCTCGTCCTCAATATCTCCGTTGGCGAGAGTGGAGATCGTCTTACCAGAGCCGCTAAGGTGTTGGAACAGCTTAGTGGCCAAGCCCCTGTGTTTTCCAAAGCAAGGTACACGGTTCGTTCCTTTGGGATTAGAAGAAATGAGAAGATTGCATGCTATGTCACTGTCAGAGGTGACAAGGCAATGCAACTTTTGGAGAGTGGTTTGAAGGTGAAGGAATATGAACTTCTCAGAAGGAACTTCAGTGATACTGGTTGCTTTGGCTTTGGCATTCAGGAGCATATCGATTTGGGAATCAAGTATGATCCTTCAACTGGTATTTATGGAATGGACTTCTTTGTTGTTCTGGAGCGTCCTGGCTATCGTGTGGGACGTCGCCGAAGGTGCAAGTCCCGTGTTGGAATCCAGCACCGTGTCACAAAGGAGGATGCTATGAAGTGGTTCCAGGTGAAATATGAGGGAGTGATCCTTAACAAGTCTCAGGCGATTGTTTAG

Predicted protein sequences of Glyma06g42460

Limit To All Plant Sequences

>Glyma06g42460.1   sequence type=predicted peptide   gene model=Glyma06g42460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAIV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain