Glyma06g42425 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42425): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42425): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42425

Feature Type:	gene_model
Chromosome:	Gm06
Start:	45771497
stop:	45773076
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42425

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G47890	AT	Annotation by Michelle Graham. TAIR10: NADH-ubiquinone oxidoreductase B8 subunit, putative \| chr5:19388806-19390409 FORWARD LENGTH=97	SoyBase	E_val: 2.00E-37	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016655	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	SoyBase	N/A	ISS
KOG3446	KOG	NADH:ubiquinone oxidoreductase NDUFA2/B8 subunit	JGI		ISS
PTHR12878	Panther	NADH-UBIQUINONE OXIDOREDUCTASE B8 SUBUNIT	JGI		ISS
PF05047	PFAM	Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain	JGI		ISS
UniRef100_Q9FIJ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 n=1 Tax=Arabidopsis thaliana RepID=NDUA2_ARATH	SoyBase	E_val: 9.00E-35	ISS
UniRef100_UPI000233710C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233710C related cluster n=1 Tax=unknown RepID=UPI000233710C	SoyBase	E_val: 2.00E-44	ISS

Expression Patterns of Glyma06g42425

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42425 not represented in the dataset	Glyma06g42425 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g42425 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g272300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42425

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42425

Limit To All Plant Sequences

>Glyma06g42425.1   sequence type=CDS   gene model=Glyma06g42425   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCCAGTCATCACCTGCAAGCTCACCCACAAGGGCTTTTGTGGAAAGGAATTATAAGGAACTAAAGACATTGAACCCAAAATTGCCCATATTAATCCGTGAGTGCAGTGGAGTTGAACCCCAATTATGGTCAAGATATGATTTGGGTGTTGAGAAAGGCATCAAATTGGAAGGCTTATTAGAGGCACAAATCTTTAAGGCACTTGAAGATTTGGTAAATATTTGA

Predicted protein sequences of Glyma06g42425

Limit To All Plant Sequences

>Glyma06g42425.1   sequence type=predicted peptide   gene model=Glyma06g42425   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCQSSPASSPTRAFVERNYKELKTLNPKLPILIRECSGVEPQLWSRYDLGVEKGIKLEGLLEAQIFKALEDLVNI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain