Glyma06g42380 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g42380

Feature Type:	gene_model
Chromosome:	Gm06
Start:	45707320
stop:	45707541
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42380

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF07333	PFAM	S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)	JGI		ISS
UniRef100_I1KEI8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KEI8_SOYBN	SoyBase	E_val: 1.00E-34	ISS

Expression Patterns of Glyma06g42380

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g42380 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g272100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42380

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42380

Limit To All Plant Sequences

>Glyma06g42380.1   sequence type=CDS   gene model=Glyma06g42380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTTCAAGGACAAGTGAAGCAACGATGACAGATGACAAATGTTTAAAAGTGTTGGATCAAAATAATTGTGACCTCACTAAGTGTCGGGCCAATTGCAATCAACAATATCATGGAACTGGACATTGCATTGGCAGAAATCCTTACAAATGTATTTGCATATACGATTGTTCTCCGTAG

Predicted protein sequences of Glyma06g42380

Limit To All Plant Sequences

>Glyma06g42380.1   sequence type=predicted peptide   gene model=Glyma06g42380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ISRTSEATMTDDKCLKVLDQNNCDLTKCRANCNQQYHGTGHCIGRNPYKCICIYDCSP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain