Glyma06g42180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42180

Feature Type:	gene_model
Chromosome:	Gm06
Start:	45400837
stop:	45402035
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G27360	AT	Annotation by Michelle Graham. TAIR10: Dynein light chain type 1 family protein \| chr4:13694032-13694517 FORWARD LENGTH=103	SoyBase	E_val: 1.00E-47	ISS
GO:0007017	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule-based process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005875	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: microtubule associated complex	SoyBase	N/A	ISS
GO:0003777	GO-mf	Annotation by Michelle Graham. GO Molecular Function: microtubule motor activity	SoyBase	N/A	ISS
KOG3430	KOG	Dynein light chain type 1	JGI		ISS
PTHR11886	Panther	DYNEIN LIGHT CHAIN	JGI		ISS
PTHR11886:SF22	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF01221	PFAM	Dynein light chain type 1	JGI		ISS
UniRef100_B9SIE5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytoplasmic dynein light chain, putative n=1 Tax=Ricinus communis RepID=B9SIE5_RICCO	SoyBase	E_val: 2.00E-55	ISS
UniRef100_I1KEH5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEH5_SOYBN	SoyBase	E_val: 2.00E-74	ISS

Expression Patterns of Glyma06g42180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42180 not represented in the dataset	Glyma06g42180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g42180

Paralog	Evidence	Comments
Glyma12g16252	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g42180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g270500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42180

Limit To All Plant Sequences

>Glyma06g42180.1   sequence type=CDS   gene model=Glyma06g42180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGAAGGCAAGGCTGTGATTGGTGAGACTGACATGCTTCAGACCATGCAGCAAGATGCTATGGATTTAGCATCCAAAGCACTCGATTTCTTTGATGTCACTGAAGCCATTAAGATTGCTCGATTTATAAAGAAGGAGTTTGATAGGATGCATGGACCTGGTTGGCAGTGTATTGTAGGCACTGATTTTGGTTCGTTTGTGACTCACTGTTGTGGCTGTTTCATCTATTTCTGCTTAGGCAACTTGGCAATTTTGCTATTCAGAGGCTCGGCTGCTCCAGAGGCACATGAAAATCGGTTCTCAGCACTAGATGCAGCCAAAGCATAA

Predicted protein sequences of Glyma06g42180

Limit To All Plant Sequences

>Glyma06g42180.1   sequence type=predicted peptide   gene model=Glyma06g42180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLEGKAVIGETDMLQTMQQDAMDLASKALDFFDVTEAIKIARFIKKEFDRMHGPGWQCIVGTDFGSFVTHCCGCFIYFCLGNLAILLFRGSAAPEAHENRFSALDAAKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain