SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g42121

Feature Type:gene_model
Chromosome:Gm06
Start:45333752
stop:45334129
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g42121
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G65920AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr5:26364323-26365657 REVERSE LENGTH=444 SoyBaseE_val: 2.00E-47ISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0000151GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
PTHR22849Panther WDSAM1 PROTEIN JGI ISS
PF04564PFAM U-box domain JGI ISS
UniRef100_Q9FHN9UniRef Annotation by Michelle Graham. Most informative UniRef hit: U-box domain-containing protein 31 n=1 Tax=Arabidopsis thaliana RepID=PUB31_ARATH SoyBaseE_val: 9.00E-45ISS
UniRef100_UPI000233A3F7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A3F7 related cluster n=1 Tax=unknown RepID=UPI000233A3F7 SoyBaseE_val: 7.00E-52ISS

Expression Patterns of Glyma06g42121
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42121 not represented in the dataset
Glyma06g42121 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g42121 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g270100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g42121
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g42121
>Glyma06g42121.1   sequence type=CDS   gene model=Glyma06g42121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAATGTTTGAGCCTCCTTGTAAGAATGATGGTTTTGAAGTCCAGATTCTAGATCTAGACATGGCGGTGAAAGATGGAGTTTTGGGTGGTGGAGTTGATTATGGGATTGTGGGAAATGGGATTCGTGAAAAATTGAATCTTGCAAAAATGATTGAAGAGTTGGACTTGTGTGAAGTTTCCTCTGTGTTCATTTGCCCAATTTCCCTTGAGCCAATGCATGACCTTGCGACCCTTTGCATTGGCCAAACCTATGAGAGGTGCAACATTCTCAAATGGTTTAGTTTGGACCACTTCACTTGCCTCACCACAATGCAAGAGCTTTGGGATGATTCCCTCACTCCTAACACCACCCTCCACTGTCTGATATCCACTTGA
Predicted protein sequences of Glyma06g42121
>Glyma06g42121.1   sequence type=predicted peptide   gene model=Glyma06g42121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPMFEPPCKNDGFEVQILDLDMAVKDGVLGGGVDYGIVGNGIREKLNLAKMIEELDLCEVSSVFICPISLEPMHDLATLCIGQTYERCNILKWFSLDHFTCLTTMQELWDDSLTPNTTLHCLIST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo