Glyma06g42071 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42071): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42071): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42071

Feature Type:	gene_model
Chromosome:	Gm06
Start:	45267162
stop:	45269641
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42071

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G27130	AT	Annotation by Michelle Graham. TAIR10: Translation initiation factor SUI1 family protein \| chr4:13604814-13605525 REVERSE LENGTH=113	SoyBase	E_val: 9.00E-74	ISS
GO:0006413	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational initiation	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity	SoyBase	N/A	ISS
KOG1770	KOG	Translation initiation factor 1 (eIF-1/SUI1)	JGI		ISS
PTHR10388	Panther	TRANSLATION FACTOR SUI1	JGI		ISS
PF01253	PFAM	Translation initiation factor SUI1	JGI		ISS
UniRef100_B3TM00	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Translational initiation factor eIF1 n=1 Tax=Elaeis guineensis RepID=B3TM00_ELAGV	SoyBase	E_val: 2.00E-72	ISS
UniRef100_C6SX76	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SX76_SOYBN	SoyBase	E_val: 5.00E-77	ISS

Expression Patterns of Glyma06g42071

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42071 not represented in the dataset	Glyma06g42071 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g42071

Paralog	Evidence	Comments
Glyma12g16390	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g42071 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g269600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42071

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42071

Limit To All Plant Sequences

>Glyma06g42071.1   sequence type=CDS   gene model=Glyma06g42071   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGAATTAGACGATCAAATTCCTACTGCCTTCGATCCTTTTGCTGATGCAAATGCTGATGACTCGGGTGCTGGGTCAAAGGAGTATGTGCATATTCGTGTACAGCAGCGAAATGGTAGGAAAAGCCTGACAACCGTTCAGGGATTGAAAAAGGAATTCAGCTATAACAAGATACTTAAAGACGTCAAGAAAGAGTTCTGTTGCAATGGAACAGTTGTTCAGGACCCAGAACTAGGACAGGTTATTCAACTTCAAGGTGATCAGAGGAAGAATGTTTCTACCTTCCTAGTCCAGGCTGGTATCGTGAAGAAGGATCATATCAAGATTCATGGTTTCTGA

Predicted protein sequences of Glyma06g42071

Limit To All Plant Sequences

>Glyma06g42071.1   sequence type=predicted peptide   gene model=Glyma06g42071   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain