SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42061): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42061): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42061

Feature Type:gene_model
Chromosome:Gm06
Start:45259629
stop:45262375
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g42061
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27130AT Annotation by Michelle Graham. TAIR10: Translation initiation factor SUI1 family protein | chr4:13604814-13605525 REVERSE LENGTH=113 SoyBaseE_val: 2.00E-72ISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
KOG1770 KOG Translation initiation factor 1 (eIF-1/SUI1) JGI ISS
PTHR10388Panther TRANSLATION FACTOR SUI1 JGI ISS
PF01253PFAM Translation initiation factor SUI1 JGI ISS
UniRef100_B3TM00UniRef Annotation by Michelle Graham. Most informative UniRef hit: Translational initiation factor eIF1 n=1 Tax=Elaeis guineensis RepID=B3TM00_ELAGV SoyBaseE_val: 8.00E-72ISS
UniRef100_UPI0001BA8548UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001BA8548 related cluster n=1 Tax=unknown RepID=UPI0001BA8548 SoyBaseE_val: 7.00E-77ISS

Expression Patterns of Glyma06g42061
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42061 not represented in the dataset
Glyma06g42061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g42061 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g269500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g42061
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g42061
>Glyma06g42061.1   sequence type=CDS   gene model=Glyma06g42061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGATTAGACGATCAAATTCCTACTGCCTTCGATCCTTTTGCTGATGCAAATGCTGATGACTCGGGTGCTGGGTCAAAGGAGTATGTGCATATTCGCGTTCAGCAGCGAAATGGTAGGAAAAGCCTGACAACCGTTCAGGGATTGAAAAAAGAATTCAGCTATAACAAGATACTTAAAGACGTTAAGAAAGAGTTCTGTTGCAATGGAACAGTTGTTCAGGACCCAGAACTAGGACAGGTTATTCAACTTCAAGGTGATCAGAGGAAGAATGTTTCTACTTTCCTAGTACAGGCTGGTATCGTGAAGAAGGATCATATCAAGATTCATGGTTTCTGA
Predicted protein sequences of Glyma06g42061
>Glyma06g42061.1   sequence type=predicted peptide   gene model=Glyma06g42061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGLDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo