Glyma06g42020 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g42020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g42020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g42020

Feature Type:	gene_model
Chromosome:	Gm06
Start:	45232727
stop:	45233398
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g42020

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20600	AT	Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family \| chr3:7194877-7195536 FORWARD LENGTH=219	SoyBase	E_val: 6.00E-31	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009626	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0009814	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction	SoyBase	N/A	ISS
GO:0009816	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction	SoyBase	N/A	ISS
GO:0009817	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0010942	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cell death	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0004871	GO-mf	Annotation by Michelle Graham. GO Molecular Function: signal transducer activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF03168	PFAM	Late embryogenesis abundant protein	JGI		ISS
UniRef100_G7JF17	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Non-race specific disease resistance protein 1-like protein b n=1 Tax=Medicago truncatula RepID=G7JF17_MEDTR	SoyBase	E_val: 4.00E-73	ISS
UniRef100_I1KEG6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KEG6_SOYBN	SoyBase	E_val: 2.00E-126	ISS

Expression Patterns of Glyma06g42020

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g42020 not represented in the dataset	Glyma06g42020 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g42020 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g269200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g42020

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g42020

Limit To All Plant Sequences

>Glyma06g42020.2   sequence type=CDS   gene model=Glyma06g42020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACAAGAACGCAACACCAACTGCTGCAGGTGCTGTTTCGGCACCCTCCTCTCCCTTGGCCTCACCGCGGCCTTCCTCTGGCTCACCCTCCGCACCTCTCCCCCCAAATGCACCCTCCAATCCCTCTACCTCCCTTCCTTCACCTCCCCCCACCACAAAAACGACACCCTCTTCTTCAACCTCTCCCTCCAAAACGACAACAAGGACAAATCCATCAAATATGGTGCTGTCCTTTTCACCTTCGCGATCTTCCTCGATAATACCACCACGCGGCCTCTCGCGAACGCGACCCTGGAGCCCTTCTACCAGGGCCGCAGCAAGACCACGCGCAAGTGGGGCTCCGCAAGAGTCCCACGCGACGGCAGAGCGATAGCGAATCGCTCTGCCGACGCCACGGTGAGGAATAACGGGAAGGTGTTCGTGCGCGTGGAGTTTAGGACTAGGGTGAGGTATAAGATATGGACGCTGTTTTATGTTAAACGGCAGCGTTTGGTTGGTGGGGCGAATGTGGAGGTGAATGCTAGCTCCGGGGAGAAGGTCGAGCCTAAGGGGATTAGGCTTGGGGAAATGCCGCCTAGGCTCGGGTCCCAAGCTGCCAAGGCTCGGAGTTGCTATGTGGCGTTTCTCGGAGTTTTGGTTACTGGATTGTTTCTCACTGCGTTTACTTGA

Predicted protein sequences of Glyma06g42020

Limit To All Plant Sequences

>Glyma06g42020.2   sequence type=predicted peptide   gene model=Glyma06g42020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQERNTNCCRCCFGTLLSLGLTAAFLWLTLRTSPPKCTLQSLYLPSFTSPHHKNDTLFFNLSLQNDNKDKSIKYGAVLFTFAIFLDNTTTRPLANATLEPFYQGRSKTTRKWGSARVPRDGRAIANRSADATVRNNGKVFVRVEFRTRVRYKIWTLFYVKRQRLVGGANVEVNASSGEKVEPKGIRLGEMPPRLGSQAAKARSCYVAFLGVLVTGLFLTAFT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain