|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G14980 | AT | Annotation by Michelle Graham. TAIR10: chaperonin 10 | chr1:5165930-5166654 REVERSE LENGTH=98 | SoyBase | E_val: 3.00E-33 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0051087 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chaperone binding | SoyBase | N/A | ISS |
| KOG1641 | KOG | Mitochondrial chaperonin | JGI | ISS | |
| PTHR10772 | Panther | GROES CHAPERONIN | JGI | ISS | |
| PF00166 | PFAM | Chaperonin 10 Kd subunit | JGI | ISS | |
| UniRef100_A2Q4J1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: GroES-like n=1 Tax=Medicago truncatula RepID=A2Q4J1_MEDTR | SoyBase | E_val: 3.00E-36 | ISS |
| UniRef100_I1KEG0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KEG0_SOYBN | SoyBase | E_val: 6.00E-61 | ISS |
|
Glyma06g41830 not represented in the dataset |
Glyma06g41830 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g41830.1 sequence type=CDS gene model=Glyma06g41830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATTTTCAATCGGGTTTTGGTGGAGAAAATTGTGCCTCCATCAAAGACCAACGCTGGCATTTTGTTACCCGAGAAATCCTCCAAGCTAAATTCCGAAAAAGTTATTGCTGTTGGCCCTGGCTTTCACAGTAAGAATGGGAAGCTAATTCCTGTGGCTGTTAAGGAAGGTGATACTGTTCTTTTGCCTGAATATGGGGGAACTGAGGTGAAGCTTGATAACAAAGATTTATTTTATACCCTCATTCAATTCTTCAACTTCATCCTGAAGTTTAATATGGTAGATATAAATGTTTGA
>Glyma06g41830.1 sequence type=predicted peptide gene model=Glyma06g41830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high IFNRVLVEKIVPPSKTNAGILLPEKSSKLNSEKVIAVGPGFHSKNGKLIPVAVKEGDTVLLPEYGGTEVKLDNKDLFYTLIQFFNFILKFNMVDINV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||