|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G16890 | AT | Annotation by Michelle Graham. TAIR10: disease resistance protein (TIR-NBS-LRR class), putative | chr4:9500506-9505455 REVERSE LENGTH=1301 | SoyBase | E_val: 3.00E-22 | ISS |
| GO:0006952 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response | SoyBase | N/A | ISS |
| GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009816 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0043231 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| GO:0043531 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ADP binding | SoyBase | N/A | ISS |
| PF01582 | PFAM | TIR domain | JGI | ISS | |
| UniRef100_Q8H6S7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Resistance protein KR3 n=5 Tax=Glycine max RepID=Q8H6S7_SOYBN | SoyBase | E_val: 1.00E-49 | ISS |
| UniRef100_Q8H6S7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Resistance protein KR3 n=5 Tax=Glycine max RepID=Q8H6S7_SOYBN | SoyBase | E_val: 1.00E-49 | ISS |
|
Glyma06g41742 not represented in the dataset |
Glyma06g41742 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g41742.1 sequence type=CDS gene model=Glyma06g41742 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTGAATCACACTTTTGTAGTAGTGAAAACATGTTCCGGTGCATCCAGATACGATGTGTTCATTAACTTCAGAGGGGAAGACACACGTTATGAATTTACTGGGCATCTCCACAAAGCTCATTGTAACAAGGGAATCCGTGCTTTCATTGATGAAGATGACCTTGAAAGAGGAGACGAAATAACAACAACACTTGAGGAGGCAATTAAAGGATCGAGGATTGCCATCACTGTGTTCTCTAAAGACTATGCTTCTTCCTCATTTTGCTTAGATGAACTTGTAACCATCTTTGGCTGCTACCCTGAATATGAATACAAGTTTATTGGGAAGATTGTTGATGATGTCTTCGACAAGATTTATAAAGCTGAAGCAAGTTGA
>Glyma06g41742.1 sequence type=predicted peptide gene model=Glyma06g41742 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLNHTFVVVKTCSGASRYDVFINFRGEDTRYEFTGHLHKAHCNKGIRAFIDEDDLERGDEITTTLEEAIKGSRIAITVFSKDYASSSFCLDELVTIFGCYPEYEYKFIGKIVDDVFDKIYKAEAS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||