SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g41742): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g41742): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g41742

Feature Type:gene_model
Chromosome:Gm06
Start:45042684
stop:45043383
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16890AT Annotation by Michelle Graham. TAIR10: disease resistance protein (TIR-NBS-LRR class), putative | chr4:9500506-9505455 REVERSE LENGTH=1301 SoyBaseE_val: 3.00E-22ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0043231GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
GO:0043531GO-mf Annotation by Michelle Graham. GO Molecular Function: ADP binding SoyBaseN/AISS
PF01582PFAM TIR domain JGI ISS
UniRef100_Q8H6S7UniRef Annotation by Michelle Graham. Best UniRef hit: Resistance protein KR3 n=5 Tax=Glycine max RepID=Q8H6S7_SOYBN SoyBaseE_val: 1.00E-49ISS
UniRef100_Q8H6S7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Resistance protein KR3 n=5 Tax=Glycine max RepID=Q8H6S7_SOYBN SoyBaseE_val: 1.00E-49ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g41742 not represented in the dataset

Glyma06g41742 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g41742.1   sequence type=CDS   gene model=Glyma06g41742   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGAATCACACTTTTGTAGTAGTGAAAACATGTTCCGGTGCATCCAGATACGATGTGTTCATTAACTTCAGAGGGGAAGACACACGTTATGAATTTACTGGGCATCTCCACAAAGCTCATTGTAACAAGGGAATCCGTGCTTTCATTGATGAAGATGACCTTGAAAGAGGAGACGAAATAACAACAACACTTGAGGAGGCAATTAAAGGATCGAGGATTGCCATCACTGTGTTCTCTAAAGACTATGCTTCTTCCTCATTTTGCTTAGATGAACTTGTAACCATCTTTGGCTGCTACCCTGAATATGAATACAAGTTTATTGGGAAGATTGTTGATGATGTCTTCGACAAGATTTATAAAGCTGAAGCAAGTTGA

>Glyma06g41742.1   sequence type=predicted peptide   gene model=Glyma06g41742   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLNHTFVVVKTCSGASRYDVFINFRGEDTRYEFTGHLHKAHCNKGIRAFIDEDDLERGDEITTTLEEAIKGSRIAITVFSKDYASSSFCLDELVTIFGCYPEYEYKFIGKIVDDVFDKIYKAEAS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo