Glyma06g41461 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g41461): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g41461): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g41461

Feature Type:	gene_model
Chromosome:	Gm06
Start:	44727846
stop:	44729802
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g41461

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07160	AT	Annotation by Michelle Graham. TAIR10: glucan synthase-like 10 \| chr3:2265142-2279383 REVERSE LENGTH=1890	SoyBase	E_val: 2.00E-58	ISS
GO:0006075	GO-bp	Annotation by Michelle Graham. GO Biological Process: (1->3)-beta-D-glucan biosynthetic process	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009556	GO-bp	Annotation by Michelle Graham. GO Biological Process: microsporogenesis	SoyBase	N/A	ISS
GO:0009846	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen germination	SoyBase	N/A	ISS
GO:0048589	GO-bp	Annotation by Michelle Graham. GO Biological Process: developmental growth	SoyBase	N/A	ISS
GO:0052543	GO-bp	Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall	SoyBase	N/A	ISS
GO:0055047	GO-bp	Annotation by Michelle Graham. GO Biological Process: generative cell mitosis	SoyBase	N/A	ISS
GO:0080092	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of pollen tube growth	SoyBase	N/A	ISS
GO:0000148	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: 1,3-beta-D-glucan synthase complex	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003843	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 1,3-beta-D-glucan synthase activity	SoyBase	N/A	ISS
PTHR12741	Panther	UNCHARACTERIZED DUF605	JGI		ISS
PTHR12741:SF4	Panther	gb def: Hypothetical protein F10M23.90 (AT4g26750/F10M23 90) (Hypothetical protein AT4g2	JGI		ISS
UniRef100_G7IAY9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Callose synthase n=1 Tax=Medicago truncatula RepID=G7IAY9_MEDTR	SoyBase	E_val: 3.00E-66	ISS
UniRef100_UPI000233D7F6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D7F6 related cluster n=1 Tax=unknown RepID=UPI000233D7F6	SoyBase	E_val: 1.00E-74	ISS

Expression Patterns of Glyma06g41461

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g41461 not represented in the dataset	Glyma06g41461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g41461 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g41461

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g41461

Limit To All Plant Sequences

>Glyma06g41461.1   sequence type=CDS   gene model=Glyma06g41461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATATGTTGTTTTGGCTTGTTACTTTAAGTGCAAAATTTGCGTTTGCTTACTTTCTTCAGATTAGGCATCTGGTGGACCCAACAAGGGCTATTACAAAAGAGGATAATATAAATTACTCTTGGCATGATTTTGTCTCTAAAATCATTAGGGTGCCTTTATTGTTGCATGCAAATAATCATAATGCTTTGACAGTTGTTAGCGTGTGGGCTCCTGTGGTGGTTGCTATTTATCTTCTAGATATTTATGTGTTTTACACACTTGTATCGGCTGTCTATGGATCCTTACTGGGGGCAAGAGATCGACTGGGAGAGGTCGTGGAGAAAAACAAGGTTGATGTTGTTCGGTTTGCCCCCTTTTGGAATGAGATCATAAGGAATCTAAGGGAGGAGGATTACCTAACCAACTTGTTATTGCTTTTAATGCCTAGGAATTCTGGGGATCTTCCTTTAGTTCAATGGCCACTTTTTCTACTTGCAAGCAAG

Predicted protein sequences of Glyma06g41461

Limit To All Plant Sequences

>Glyma06g41461.1   sequence type=predicted peptide   gene model=Glyma06g41461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYMLFWLVTLSAKFAFAYFLQIRHLVDPTRAITKEDNINYSWHDFVSKIIRVPLLLHANNHNALTVVSVWAPVVVAIYLLDIYVFYTLVSAVYGSLLGARDRLGEVVEKNKVDVVRFAPFWNEIIRNLREEDYLTNLLLLLMPRNSGDLPLVQWPLFLLASK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain