SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g41461): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g41461): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g41461

Feature Type:gene_model
Chromosome:Gm06
Start:44727846
stop:44729802
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07160AT Annotation by Michelle Graham. TAIR10: glucan synthase-like 10 | chr3:2265142-2279383 REVERSE LENGTH=1890 SoyBaseE_val: 2.00E-58ISS
GO:0006075GO-bp Annotation by Michelle Graham. GO Biological Process: (1->3)-beta-D-glucan biosynthetic process SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0009846GO-bp Annotation by Michelle Graham. GO Biological Process: pollen germination SoyBaseN/AISS
GO:0048589GO-bp Annotation by Michelle Graham. GO Biological Process: developmental growth SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0055047GO-bp Annotation by Michelle Graham. GO Biological Process: generative cell mitosis SoyBaseN/AISS
GO:0080092GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of pollen tube growth SoyBaseN/AISS
GO:0000148GO-cc Annotation by Michelle Graham. GO Cellular Compartment: 1,3-beta-D-glucan synthase complex SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003843GO-mf Annotation by Michelle Graham. GO Molecular Function: 1,3-beta-D-glucan synthase activity SoyBaseN/AISS
PTHR12741Panther UNCHARACTERIZED DUF605 JGI ISS
PTHR12741:SF4Panther gb def: Hypothetical protein F10M23.90 (AT4g26750/F10M23 90) (Hypothetical protein AT4g2 JGI ISS
UniRef100_G7IAY9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Callose synthase n=1 Tax=Medicago truncatula RepID=G7IAY9_MEDTR SoyBaseE_val: 3.00E-66ISS
UniRef100_UPI000233D7F6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D7F6 related cluster n=1 Tax=unknown RepID=UPI000233D7F6 SoyBaseE_val: 1.00E-74ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g41461 not represented in the dataset

Glyma06g41461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g41461.1   sequence type=CDS   gene model=Glyma06g41461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATATGTTGTTTTGGCTTGTTACTTTAAGTGCAAAATTTGCGTTTGCTTACTTTCTTCAGATTAGGCATCTGGTGGACCCAACAAGGGCTATTACAAAAGAGGATAATATAAATTACTCTTGGCATGATTTTGTCTCTAAAATCATTAGGGTGCCTTTATTGTTGCATGCAAATAATCATAATGCTTTGACAGTTGTTAGCGTGTGGGCTCCTGTGGTGGTTGCTATTTATCTTCTAGATATTTATGTGTTTTACACACTTGTATCGGCTGTCTATGGATCCTTACTGGGGGCAAGAGATCGACTGGGAGAGGTCGTGGAGAAAAACAAGGTTGATGTTGTTCGGTTTGCCCCCTTTTGGAATGAGATCATAAGGAATCTAAGGGAGGAGGATTACCTAACCAACTTGTTATTGCTTTTAATGCCTAGGAATTCTGGGGATCTTCCTTTAGTTCAATGGCCACTTTTTCTACTTGCAAGCAAG

>Glyma06g41461.1   sequence type=predicted peptide   gene model=Glyma06g41461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYMLFWLVTLSAKFAFAYFLQIRHLVDPTRAITKEDNINYSWHDFVSKIIRVPLLLHANNHNALTVVSVWAPVVVAIYLLDIYVFYTLVSAVYGSLLGARDRLGEVVEKNKVDVVRFAPFWNEIIRNLREEDYLTNLLLLLMPRNSGDLPLVQWPLFLLASK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo