SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g41351

Feature Type:gene_model
Chromosome:Gm06
Start:44614155
stop:44614869
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g41351
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64185AT Annotation by Michelle Graham. TAIR10: Lactoylglutathione lyase / glyoxalase I family protein | chr1:23824527-23825152 FORWARD LENGTH=118 SoyBaseE_val: 3.00E-56ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
UniRef100_B9RCL3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Catalytic, putative n=1 Tax=Ricinus communis RepID=B9RCL3_RICCO SoyBaseE_val: 9.00E-59ISS
UniRef100_UPI000233942BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233942B related cluster n=1 Tax=unknown RepID=UPI000233942B SoyBaseE_val: 2.00E-76ISS

Expression Patterns of Glyma06g41351
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g41351 not represented in the dataset
Glyma06g41351 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g41351 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g264500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g41351
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g41351
>Glyma06g41351.1   sequence type=CDS   gene model=Glyma06g41351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCGTCATTCAGGTGGATATTACAACTACACAAGGATGTTCCAAAAGCTGCACGATTCTACTCCGAAGGCTTGGACTTCAGCATCAATGTCTGCAGCCTTTGTTGGGCCGAACTCCAATCCGGTTATCTCAAGCTTGCATTCTCCCAACAGCAGCAAGCCACACAGAAAGGGTACTCATCGCTTCTATCATTTACTGTGACTGATATGAACAATACAGTAACTAAATTAATGGCGTTAGGAGCTGAACTAGATGGACCCATCAAATATGAGGTCCATGGAAAGATTGCAGCTATGCGGTGTATTGATGGACATGTCTTAGGCCTCTGTGATACATAA
Predicted protein sequences of Glyma06g41351
>Glyma06g41351.1   sequence type=predicted peptide   gene model=Glyma06g41351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAASFRWILQLHKDVPKAARFYSEGLDFSINVCSLCWAELQSGYLKLAFSQQQQATQKGYSSLLSFTVTDMNNTVTKLMALGAELDGPIKYEVHGKIAAMRCIDGHVLGLCDT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo