SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g41210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g41210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g41210

Feature Type:gene_model
Chromosome:Gm06
Start:44493155
stop:44495972
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54580AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr5:22171332-22172656 FORWARD LENGTH=156 SoyBaseE_val: 1.00E-54ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG0114 KOG Predicted RNA-binding protein (RRM superfamily) JGI ISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PTHR24012:SF32Panther SUBFAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_D7MUB5UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA recognition motif-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MUB5_ARALL SoyBaseE_val: 1.00E-52ISS
UniRef100_I1KED0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KED0_SOYBN SoyBaseE_val: 1.00E-100ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g41210 not represented in the dataset

Glyma06g41210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g263200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g41210.1   sequence type=CDS   gene model=Glyma06g41210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACGAGAGCAGCAGTGGCGGCGCCGCGCGTTTTGCGGCGGTTTTTCTGCACAAACTCAGCCTCTTCTTCTTTCCCCTTCGTTTCTACGCTGCCTCCCGGTGCCACCCCCGCCCCAACCCGACCCACGGCGGAGCCCAACACCAACCTCTTCGTCTCTGGTCTTAGTAAACGTACTAATACAGAAAGGCTTCGAGAGGAGTTTGCAAAGTTCGGTGAAGTTGTTCATGCGAGGGTGGTAACTGATCGAGTCTCAGGTTACTCTAAGGGGTTTGGTTTTGTTCAATATGCTACAATAGAAGATGCTGCAAAGGGCATTGAAGGCATGGATGGCAAGTTTTTGGACGGTTGGGTTATATTTGCAGAGTATGCGAGACCAAGACCACCACCAGGCCAACCTCTAAATAGCAACAGTTCTCAGTATGGCCGGCAGTGA

>Glyma06g41210.1   sequence type=predicted peptide   gene model=Glyma06g41210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATRAAVAAPRVLRRFFCTNSASSSFPFVSTLPPGATPAPTRPTAEPNTNLFVSGLSKRTNTERLREEFAKFGEVVHARVVTDRVSGYSKGFGFVQYATIEDAAKGIEGMDGKFLDGWVIFAEYARPRPPPGQPLNSNSSQYGRQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo