SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g40995): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g40995): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g40995

Feature Type:gene_model
Chromosome:Gm06
Start:44287369
stop:44289913
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27300AT Annotation by Michelle Graham. TAIR10: S-locus lectin protein kinase family protein | chr4:13669308-13672348 REVERSE LENGTH=815 SoyBaseE_val: 7.00E-39ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0048544GO-bp Annotation by Michelle Graham. GO Biological Process: recognition of pollen SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
GO:0031625GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin protein ligase binding SoyBaseN/AISS
PTHR11795Panther PROTEIN KINASE JGI ISS
PTHR11795:SF72Panther RECEPTOR-LIKE PROTEIN KINASE-RELATED JGI ISS
PF00954PFAM S-locus glycoprotein family JGI ISS
PF08276PFAM PAN-like domain JGI ISS
UniRef100_G7JZD9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine-rich receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=G7JZD9_MEDTR SoyBaseE_val: 2.00E-57ISS
UniRef100_UPI000233AA22UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AA22 related cluster n=1 Tax=unknown RepID=UPI000233AA22 SoyBaseE_val: 5.00E-104ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g40995 not represented in the dataset

Glyma06g40995 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g261600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g40995.1   sequence type=CDS   gene model=Glyma06g40995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAATGGAAACCATGGAGAGGAAATCCAAACGGGAGAGAATTCAGAGGACCTACCAGTGGCATACCAAACCCTTCTCTGTCGCCAACGCAACATTTGGATCCCTGAAAATGGAACATGGAGGTTGTTTCAAACTGCACCGAGAGACATTTGTGACACTTATAGTCCGTGTGGTTCTTACGCGAATTGTATGGTTGATTCATCGCCAGTGTGTCAGTGTTTAGAAGGGTTCAAACCGAAATCTTTGGATACAATGGAACAAGGATGTGTGAGAAGTGAACCGTGGAGCTGCAAGGTGGAAGGGAGAGATGGGTTTAGAAAATTTGTTGGGTTGAAGTTTCCGGATACTACACATTCTTGGATTAATAAAAGTATGACACTCGAGGAATGCAAGGTTAAATGTTGGGAAAATTGTTCGTGCACAGCTTATGCAAACTTGGACATAAGAGGAGCAGGAAGTGGGTGTTCCATTTGGTTTGCTGATCTTATTGATTTGAAAGTTGTTTCACAAAGTGGACAATATCTCAATATTTGA

>Glyma06g40995.1   sequence type=predicted peptide   gene model=Glyma06g40995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKNGNHGEEIQTGENSEDLPVAYQTLLCRQRNIWIPENGTWRLFQTAPRDICDTYSPCGSYANCMVDSSPVCQCLEGFKPKSLDTMEQGCVRSEPWSCKVEGRDGFRKFVGLKFPDTTHSWINKSMTLEECKVKCWENCSCTAYANLDIRGAGSGCSIWFADLIDLKVVSQSGQYLNI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo