SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g40730

Feature Type:gene_model
Chromosome:Gm06
Start:43891776
stop:43894380
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g40730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54500AT Annotation by Michelle Graham. TAIR10: flavodoxin-like quinone reductase 1 | chr5:22124674-22126256 FORWARD LENGTH=204 SoyBaseE_val: 1.00E-107ISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0010181GO-mf Annotation by Michelle Graham. GO Molecular Function: FMN binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016655GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor SoyBaseN/AISS
KOG3135 KOG 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein JGI ISS
PF03358PFAM NADPH-dependent FMN reductase JGI ISS
UniRef100_G7ITL8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavoprotein wrbA n=1 Tax=Medicago truncatula RepID=G7ITL8_MEDTR SoyBaseE_val: 6.00E-107ISS
UniRef100_UPI000233AA25UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AA25 related cluster n=1 Tax=unknown RepID=UPI000233AA25 SoyBaseE_val: 2.00E-156ISS

Expression Patterns of Glyma06g40730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g40730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g259600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g40730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g40730
>Glyma06g40730.1   sequence type=CDS   gene model=Glyma06g40730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTGCCAAAGTTTATATTGTGTATTACTCAATGTATGGTCATGCGGAAACACTAGCTAGGGAAATATTGCGCGGGGCTAATTCTGTAGAGGGTGTTGAGGCCAAACTGTGGCAGATACCTGAGACACTGCCACCTGAGGAGCTTGTTAGGCTGAGAGCACCACCAAAGAGTGATGTACCAATCATTAACCCTTTTAAACTGCCCGTAGCAGATGGTTTTGTCTTTGGTTTTCCAACAAGATTGGGAATAATGGCTGCTCAGTTCAAGGCTTTCCTGGATTCAACTCAATATCTATGGAAAGCGCAAATGCTTGCGTGCAAGCCTGCTGGAATCTTCTATAGCACCAGTTGCCAAGGTGTTGGACAAGAGACTGCGCCGTTTACTGCTATCACTCAGCTGGTTCATCATGGAATGATATTTGTTCCAATAGGATACACATTCGGTCCTGGCATGTTCGAGATGAAGGAGCCGAAAGGTGGAAGTCCTTATGGTGCAGGAACTTACATTGGTGATGGCTCTAGGCAGCCAACTGAGCTTGAGTTGCAGCAAGCATTCCACCAAGGGAATCATATCGCCACCATCATAAAGAAGTTCAAGGAAGATGCTCACCCAATTTTTACTCTACACAATAGAGGATATTGA
Predicted protein sequences of Glyma06g40730
>Glyma06g40730.1   sequence type=predicted peptide   gene model=Glyma06g40730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPAKVYIVYYSMYGHAETLAREILRGANSVEGVEAKLWQIPETLPPEELVRLRAPPKSDVPIINPFKLPVADGFVFGFPTRLGIMAAQFKAFLDSTQYLWKAQMLACKPAGIFYSTSCQGVGQETAPFTAITQLVHHGMIFVPIGYTFGPGMFEMKEPKGGSPYGAGTYIGDGSRQPTELELQQAFHQGNHIATIIKKFKEDAHPIFTLHNRGY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo