SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g40540

Feature Type:gene_model
Chromosome:Gm06
Start:43703245
stop:43703679
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g40540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53035AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G15358.1); Has 49 Blast hits to 49 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 49; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:19761866-19762318 REVERSE LENGTH=150 SoyBaseE_val: 1.00E-42ISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KE85UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE85_SOYBN SoyBaseE_val: 1.00E-77ISS

Expression Patterns of Glyma06g40540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g40540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g40540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g40540
>Glyma06g40540.1   sequence type=CDS   gene model=Glyma06g40540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTCTTCTATATATGCCCTTATGTGTGTTCTTCATTCCACAATAGCTCTTACTTGTGGAGCTTTGATGATATTCTACTCCAAAGAGATCTCTGTGCTTGGCCACAGATCCAAGACCGCAAGCATGCTTCAAGGGACAACACCCCATGATCAGCTTCTGATTGACACCTCTGATTCCTTCTCTGGCTTGTTGTTGTTCACAATAGGATTCCTTCTCTTGATGGTTGCTTTTAGGAAGCATGGGGGTCTTGCACATGAATGGCCTAGGCATGTTGTTGGGGACATAGCATTGGCAATTTCATGGGTCTTTTTTCTTGTGTACACATGGAGAGAGAAATATGATTAG
Predicted protein sequences of Glyma06g40540
>Glyma06g40540.1   sequence type=predicted peptide   gene model=Glyma06g40540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSSIYALMCVLHSTIALTCGALMIFYSKEISVLGHRSKTASMLQGTTPHDQLLIDTSDSFSGLLLFTIGFLLLMVAFRKHGGLAHEWPRHVVGDIALAISWVFFLVYTWREKYD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo