SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g40461

Feature Type:gene_model
Chromosome:Gm06
Start:43578613
stop:43579893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g40461
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61500AT Annotation by Michelle Graham. TAIR10: S-locus lectin protein kinase family protein | chr1:22689729-22692881 REVERSE LENGTH=804 SoyBaseE_val: 8.00E-33ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0048544GO-bp Annotation by Michelle Graham. GO Biological Process: recognition of pollen SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF430Panther SUBFAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_B9SIG2UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-locus-specific glycoprotein S13, putative n=1 Tax=Ricinus communis RepID=B9SIG2_RICCO SoyBaseE_val: 3.00E-33ISS
UniRef100_UPI000233A8ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A8AD related cluster n=1 Tax=unknown RepID=UPI000233A8AD SoyBaseE_val: 6.00E-40ISS

Expression Patterns of Glyma06g40461
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g40461 not represented in the dataset
Glyma06g40461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g40461 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g40461
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g40461
>Glyma06g40461.1   sequence type=CDS   gene model=Glyma06g40461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATGCGCCGAACTTCAACATCAAAATCTTGTTGAATTTCTTGGATGTTGCATTAAAGAAGATGAGAAATTGCTAAGATATGAATATATGGCGAACAGAAGCTTAGACTTCTTTCTTTTTGATTCTAACCGAACTAAACTTTTTGACTGGCCTAAGCGTTTGTACATTATAAATGAAGTTGCTCGTGGACTACTTCATCTCCATGAAGACTCAAGACTAAGGATCGTACACAAAGATCTTAAGGTCATCAAATTGAAGGATAAACGAGAAGAGTAG
Predicted protein sequences of Glyma06g40461
>Glyma06g40461.1   sequence type=predicted peptide   gene model=Glyma06g40461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLCAELQHQNLVEFLGCCIKEDEKLLRYEYMANRSLDFFLFDSNRTKLFDWPKRLYIINEVARGLLHLHEDSRLRIVHKDLKVIKLKDKREE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo