|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G41905 | AT | Annotation by Michelle Graham. TAIR10: BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr2:17495766-17495951 FORWARD LENGTH=61 | SoyBase | E_val: 3.00E-15 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_D7LHZ7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LHZ7_ARALL | SoyBase | E_val: 8.00E-12 | ISS |
| UniRef100_UPI000233A8A9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A8A9 related cluster n=1 Tax=unknown RepID=UPI000233A8A9 | SoyBase | E_val: 7.00E-31 | ISS |
|
Glyma06g40291 not represented in the dataset |
Glyma06g40291 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g257800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g40291.1 sequence type=CDS gene model=Glyma06g40291 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACATGAAGAAGGTCACTTGTGCTGTTCTCATCGCCGCCGCCTCCGTGAGCGCTGTGGTGGCTGCCACTGAGGTTCCAGCCCCTGCCCCCGGCCCAAGCAGTGGAGCTTCAGCTAGCTTGCCCCTTATTGGCTCCTTGGTTGGTGCCTCAGTCTTGTCTTTCTTTGCCTTGTTCCACTAA
>Glyma06g40291.1 sequence type=predicted peptide gene model=Glyma06g40291 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDMKKVTCAVLIAAASVSAVVAATEVPAPAPGPSSGASASLPLIGSLVGASVLSFFALFH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||