|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G08450 | AT | Annotation by Michelle Graham. TAIR10: calreticulin 3 | chr1:2668008-2671800 REVERSE LENGTH=370 | SoyBase | E_val: 1.00E-26 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0006995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation | SoyBase | N/A | ISS |
| GO:0009617 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to bacterium | SoyBase | N/A | ISS |
| GO:0009626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0010204 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-independent | SoyBase | N/A | ISS |
| GO:0031347 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of defense response | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0045087 | GO-bp | Annotation by Michelle Graham. GO Biological Process: innate immune response | SoyBase | N/A | ISS |
| GO:0046283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound metabolic process | SoyBase | N/A | ISS |
| GO:0055074 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium ion homeostasis | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005789 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
| GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
| PTHR11073 | Panther | CALRETICULIN AND CALNEXIN | JGI | ISS | |
| PF00262 | PFAM | Calreticulin family | JGI | ISS | |
| UniRef100_C6TCW1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TCW1_SOYBN | SoyBase | E_val: 6.00E-29 | ISS |
| UniRef100_G7KRL3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Calreticulin-3 n=2 Tax=Medicago truncatula RepID=G7KRL3_MEDTR | SoyBase | E_val: 3.00E-27 | ISS |
|
Glyma06g40270 not represented in the dataset |
Glyma06g40270 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g40270.1 sequence type=CDS gene model=Glyma06g40270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GATATTGTAGGTATTCAAACATCGAGTGATGCCAAACACTTTTCCATCTCTGCAAAAATACCAGAATTCACAAACAAGAACAAAATATTGGTCCTTCAGTATTCTGTAAAATTTGAGCAAGAGATTGAATGTGGTGGAGGTTACATCAAGCTTCTCTCTGGATTATTTAATCAAAAGAAGTTT
>Glyma06g40270.1 sequence type=predicted peptide gene model=Glyma06g40270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high DIVGIQTSSDAKHFSISAKIPEFTNKNKILVLQYSVKFEQEIECGGGYIKLLSGLFNQKKF
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||