SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g40075

Feature Type:gene_model
Chromosome:Gm06
Start:43148042
stop:43149490
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g40075
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07830AT Annotation by Michelle Graham. TAIR10: glucuronidase 2 | chr5:2504168-2506567 FORWARD LENGTH=543 SoyBaseE_val: 6.00E-42ISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004566GO-mf Annotation by Michelle Graham. GO Molecular Function: beta-glucuronidase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PTHR14363Panther HEPARANASE-RELATED JGI ISS
PTHR14363:SF7Panther HEPARANASE-RELATED JGI ISS
PF03662PFAM Glycosyl hydrolase family 79, N-terminal domain JGI ISS
UniRef100_B9RLS7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heparanase-2, putative n=1 Tax=Ricinus communis RepID=B9RLS7_RICCO SoyBaseE_val: 2.00E-44ISS
UniRef100_UPI000233DBB1UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DBB1 related cluster n=1 Tax=unknown RepID=UPI000233DBB1 SoyBaseE_val: 3.00E-68ISS

Expression Patterns of Glyma06g40075
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g40075 not represented in the dataset
Glyma06g40075 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g40075 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g256800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g40075
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g40075
>Glyma06g40075.1   sequence type=CDS   gene model=Glyma06g40075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTATTTGGACTTGAAGATCCCAATGGTAGTGATGAGCATCTTGAAAGGAAGATTCTAGATCTTGAGCGCTTGAGTAGGGTGGAATCAATTTTTGGCAATCTTTCAGAAACCATCAAAATATATGGTCCTTGGTCTTCTGCATGGGTAGGAGAAGCTGGAGGGGCATACAACAGTGGTGGCAATCATGTTTCTAACAGATTTCTAAACAGCTTTTGGTACTTAGATCAACTTGGAATAGCATCCTGCTACAACACTAAAGTCTATTGCAGGCAGACTTTAATTGGAGGGAATTATGGCCTTCTCAATGCCACCACCTTTGCTCCCAATCCTGACTACTACAGGTAA
Predicted protein sequences of Glyma06g40075
>Glyma06g40075.1   sequence type=predicted peptide   gene model=Glyma06g40075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVFGLEDPNGSDEHLERKILDLERLSRVESIFGNLSETIKIYGPWSSAWVGEAGGAYNSGGNHVSNRFLNSFWYLDQLGIASCYNTKVYCRQTLIGGNYGLLNATTFAPNPDYYR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo