Glyma06g40075 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g40075): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g40075): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g40075

Feature Type:	gene_model
Chromosome:	Gm06
Start:	43148042
stop:	43149490
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g40075

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G07830	AT	Annotation by Michelle Graham. TAIR10: glucuronidase 2 \| chr5:2504168-2506567 FORWARD LENGTH=543	SoyBase	E_val: 6.00E-42	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0004566	GO-mf	Annotation by Michelle Graham. GO Molecular Function: beta-glucuronidase activity	SoyBase	N/A	ISS
GO:0016798	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds	SoyBase	N/A	ISS
PTHR14363	Panther	HEPARANASE-RELATED	JGI		ISS
PTHR14363:SF7	Panther	HEPARANASE-RELATED	JGI		ISS
PF03662	PFAM	Glycosyl hydrolase family 79, N-terminal domain	JGI		ISS
UniRef100_B9RLS7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heparanase-2, putative n=1 Tax=Ricinus communis RepID=B9RLS7_RICCO	SoyBase	E_val: 2.00E-44	ISS
UniRef100_UPI000233DBB1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DBB1 related cluster n=1 Tax=unknown RepID=UPI000233DBB1	SoyBase	E_val: 3.00E-68	ISS

Expression Patterns of Glyma06g40075

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g40075 not represented in the dataset	Glyma06g40075 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g40075 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g256800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g40075

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g40075

Limit To All Plant Sequences

>Glyma06g40075.1   sequence type=CDS   gene model=Glyma06g40075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTATTTGGACTTGAAGATCCCAATGGTAGTGATGAGCATCTTGAAAGGAAGATTCTAGATCTTGAGCGCTTGAGTAGGGTGGAATCAATTTTTGGCAATCTTTCAGAAACCATCAAAATATATGGTCCTTGGTCTTCTGCATGGGTAGGAGAAGCTGGAGGGGCATACAACAGTGGTGGCAATCATGTTTCTAACAGATTTCTAAACAGCTTTTGGTACTTAGATCAACTTGGAATAGCATCCTGCTACAACACTAAAGTCTATTGCAGGCAGACTTTAATTGGAGGGAATTATGGCCTTCTCAATGCCACCACCTTTGCTCCCAATCCTGACTACTACAGGTAA

Predicted protein sequences of Glyma06g40075

Limit To All Plant Sequences

>Glyma06g40075.1   sequence type=predicted peptide   gene model=Glyma06g40075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVFGLEDPNGSDEHLERKILDLERLSRVESIFGNLSETIKIYGPWSSAWVGEAGGAYNSGGNHVSNRFLNSFWYLDQLGIASCYNTKVYCRQTLIGGNYGLLNATTFAPNPDYYR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain