SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g39970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g39970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g39970

Feature Type:gene_model
Chromosome:Gm06
Start:43017834
stop:43020184
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g39970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27270AT Annotation by Michelle Graham. TAIR10: Quinone reductase family protein | chr4:13661458-13663243 REVERSE LENGTH=205 SoyBaseE_val: 5.00E-101ISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0010181GO-mf Annotation by Michelle Graham. GO Molecular Function: FMN binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG3135 KOG 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein JGI ISS
PF03358PFAM NADPH-dependent FMN reductase JGI ISS
UniRef100_D7MEH6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Quinone reductase family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MEH6_ARALL SoyBaseE_val: 2.00E-99ISS
UniRef100_I1KE62UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE62_SOYBN SoyBaseE_val: 2.00E-161ISS

Expression Patterns of Glyma06g39970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g39970 not represented in the dataset
Glyma06g39970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g39970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g256200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g39970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g39970
>Glyma06g39970.1   sequence type=CDS   gene model=Glyma06g39970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGTCAAAGTTTATATTGTGTACTACTCAATGCTTGGGCACGTGGAAAGATTAGCTCAAGAAATAAAGACAGGAGCCGATTCTGTACCAGGGGTTGAGTCCCAACTATGGCAGGTACCCGAGACACTATCAACTGAGGAGCTTGAGGCATTGAGAGCACCGCCCAAGAGTGATGTACCAATCATCACCAGAAATGAGCTCCGTGATGCTGATGGTTTTGTCTTTGGCTTCCCAACAAGATTTGGAATGATGGCTGCTCAGTTTCAAGCTTTCCTCGACTCAATCGGATTACTATGGGACGAAGAAGATCAATTTCTTGAAGGCAAGCCTGCTGGAATGTTCTTCAGCACCGGTTGCCAAGGTGGTGGACAAGAAACTACAGCGCTCACTGCTATCCCTCAGTTGGTTAATCATGGATTGTTGTTTGTTCCAATTTTGTATACATTGGGTGCTGGAATCAGTGGAATGTTTGAGATCGAGGAAGTGAGGGGTGGGAGTCCCTTTGGTTCTGGAACATATGCTGGTACTGATGGCAAAAGGAACCCAACTGAGATTGAGCTGAGGCAAGCATTCCACCAAGGGAAATGTATAGCCGCCATCTCAAAGAAGCTTAAGCGAGATCCTCAAAATTATCTCCATAATATTGCTCGCAGATGGTGA
Predicted protein sequences of Glyma06g39970
>Glyma06g39970.1   sequence type=predicted peptide   gene model=Glyma06g39970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTVKVYIVYYSMLGHVERLAQEIKTGADSVPGVESQLWQVPETLSTEELEALRAPPKSDVPIITRNELRDADGFVFGFPTRFGMMAAQFQAFLDSIGLLWDEEDQFLEGKPAGMFFSTGCQGGGQETTALTAIPQLVNHGLLFVPILYTLGAGISGMFEIEEVRGGSPFGSGTYAGTDGKRNPTEIELRQAFHQGKCIAAISKKLKRDPQNYLHNIARRW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo