Glyma06g39656 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g39656

Feature Type:	gene_model
Chromosome:	Gm06
Start:	42440255
stop:	42444093
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g39656

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13677	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; Has 24 Blast hits to 24 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 24; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:4476296-4476611 FORWARD LENGTH=76	SoyBase	E_val: 7.00E-20	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1KE46	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE46_SOYBN	SoyBase	E_val: 1.00E-48	ISS
UniRef100_Q75ID7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q75ID7_ORYSJ	SoyBase	E_val: 5.00E-16	ISS

Expression Patterns of Glyma06g39656

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g39656 not represented in the dataset	Glyma06g39656 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g39656

Paralog	Evidence	Comments
Glyma12g22371	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g39656 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g39656

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g39656

Limit To All Plant Sequences

>Glyma06g39656.1   sequence type=CDS   gene model=Glyma06g39656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGAGATGACCAAACACATTCGTCTTGTTTCAAAACGGTGCGCTTTTGAAAGAATCGTTGTTCTTCTCTCTTTCTCCTCTGAAAAAGTGGATTCATTTGATCATTTAAAGGGTTGCAATACCCTAGATCAAATGATGGAGACTGGAGACATTAATCAGCCTGAACCACTGAAACAGGTGTGGTGTGAGAAAAAACAGGCTGCCGTTCATGAAGAAATGAATAGAATGAACCAACTGCCTGCAAACAGTGCATATGCTACACATCGTATGAAGGTTCTAAATAAAATTTTGCAACTCATGTCAGTTCAGAGAACTGTATCACAAGAGCAGGAATTGGAGTTGCTTTTTGCTGGCCTTTCTTTGTGA

Predicted protein sequences of Glyma06g39656

Limit To All Plant Sequences

>Glyma06g39656.1   sequence type=predicted peptide   gene model=Glyma06g39656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEMTKHIRLVSKRCAFERIVVLLSFSSEKVDSFDHLKGCNTLDQMMETGDINQPEPLKQVWCEKKQAAVHEEMNRMNQLPANSAYATHRMKVLNKILQLMSVQRTVSQEQELELLFAGLSL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain