SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g39397

Feature Type:gene_model
Chromosome:Gm06
Start:42204138
stop:42205931
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80410AT Annotation by Michelle Graham. TAIR10: tetratricopeptide repeat (TPR)-containing protein | chr1:30227963-30234832 REVERSE LENGTH=897 SoyBaseE_val: 6.00E-22ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
UniRef100_G7IMD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: NMDA receptor-regulated protein n=1 Tax=Medicago truncatula RepID=G7IMD3_MEDTR SoyBaseE_val: 6.00E-23ISS
UniRef100_I1KV97UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV97_SOYBN SoyBaseE_val: 4.00E-28ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g39397 not represented in the dataset

Glyma06g39397 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g252800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g39397.1   sequence type=CDS   gene model=Glyma06g39397   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCTAAATATTATTGCGCAGATCTCATTGTTAGAGGAATGTGAGTATCTTGAGAGAGCTCTGGAGGAGTTGCACAAAAAAGAATCTAAAATTGTTGATAAACTTGTATACAAAGAACAAGAGGTTTCACTTTTAGTAAAGCTTGGTCACCTAGAAGAAGGCAAAGCTTTGTACTGGGCATTACTTTCCATGAATCCTGATAATTATTGGTGA

>Glyma06g39397.1   sequence type=predicted peptide   gene model=Glyma06g39397   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLNIIAQISLLEECEYLERALEELHKKESKIVDKLVYKEQEVSLLVKLGHLEEGKALYWALLSMNPDNYW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo