|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G80410 | AT | Annotation by Michelle Graham. TAIR10: tetratricopeptide repeat (TPR)-containing protein | chr1:30227963-30234832 REVERSE LENGTH=897 | SoyBase | E_val: 6.00E-22 | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| UniRef100_G7IMD3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NMDA receptor-regulated protein n=1 Tax=Medicago truncatula RepID=G7IMD3_MEDTR | SoyBase | E_val: 6.00E-23 | ISS |
| UniRef100_I1KV97 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV97_SOYBN | SoyBase | E_val: 4.00E-28 | ISS |
|
Glyma06g39397 not represented in the dataset |
Glyma06g39397 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g252800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g39397.1 sequence type=CDS gene model=Glyma06g39397 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACCTAAATATTATTGCGCAGATCTCATTGTTAGAGGAATGTGAGTATCTTGAGAGAGCTCTGGAGGAGTTGCACAAAAAAGAATCTAAAATTGTTGATAAACTTGTATACAAAGAACAAGAGGTTTCACTTTTAGTAAAGCTTGGTCACCTAGAAGAAGGCAAAGCTTTGTACTGGGCATTACTTTCCATGAATCCTGATAATTATTGGTGA
>Glyma06g39397.1 sequence type=predicted peptide gene model=Glyma06g39397 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDLNIIAQISLLEECEYLERALEELHKKESKIVDKLVYKEQEVSLLVKLGHLEEGKALYWALLSMNPDNYW*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||