SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g39232

Feature Type:gene_model
Chromosome:Gm06
Start:42131966
stop:42136994
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g39232
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15530AT Annotation by Michelle Graham. TAIR10: pyruvate orthophosphate dikinase | chr4:8864828-8869183 REVERSE LENGTH=875 SoyBaseE_val: 2.00E-25ISS
GO:0016310GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0016874GO-mf Annotation by Michelle Graham. GO Molecular Function: ligase activity SoyBaseN/AISS
GO:0050242GO-mf Annotation by Michelle Graham. GO Molecular Function: pyruvate, phosphate dikinase activity SoyBaseN/AISS
PTHR22931Panther PHOSPHOENOLPYRUVATE DIKINASE-RELATED JGI ISS
PTHR22931:SF9Panther PYRUVATE, PHOSPHATE DIKINASE, CHLOROPLAST JGI ISS
PF02896PFAM PEP-utilising enzyme, TIM barrel domain JGI ISS
UniRef100_G7JHV6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pyruvate orthophosphate dikinase n=1 Tax=Medicago truncatula RepID=G7JHV6_MEDTR SoyBaseE_val: 3.00E-27ISS
UniRef100_I1MRB8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MRB8_SOYBN SoyBaseE_val: 3.00E-30ISS

Expression Patterns of Glyma06g39232
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g39232 not represented in the dataset
Glyma06g39232 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g39232 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g252400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g39232
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g39232
>Glyma06g39232.1   sequence type=CDS   gene model=Glyma06g39232   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTTTGAATGACCTACTTGCACTTGGCGGTGGGGCTGCTTGGTTAACGTTGCACAAGCTCAATCTGCAAACACCACCACTGATCCTTCCGAAGGAATTAAGGCATCAAGTGAATTTAATAAGGAATGTTGCTGATAAAGTGTTGTCTGAGATGGGTTCTTCTTTAAGCTATAAGGTTCGAACTATGATTGAAGTTCCAAGGGATGCACTAGTTGCAGATGAGATTGCAAAGGAAGCAGAGTTCTTTTCGTTTGGAACCAATGACCTTTGTCAGCAGAATCTTGGGGTTTAA
Predicted protein sequences of Glyma06g39232
>Glyma06g39232.1   sequence type=predicted peptide   gene model=Glyma06g39232   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCLNDLLALGGGAAWLTLHKLNLQTPPLILPKELRHQVNLIRNVADKVLSEMGSSLSYKVRTMIEVPRDALVADEIAKEAEFFSFGTNDLCQQNLGV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo