Glyma06g39206 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g39206

Feature Type:	gene_model
Chromosome:	Gm06
Start:	42054060
stop:	42055322
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g39206

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G03610	AT	Annotation by Michelle Graham. TAIR10: GDSL-like Lipase/Acylhydrolase superfamily protein \| chr5:915650-918326 FORWARD LENGTH=359	SoyBase	E_val: 2.00E-42	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
PF00657	PFAM	GDSL-like Lipase/Acylhydrolase	JGI		ISS
UniRef100_G7I358	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GDSL esterase/lipase n=1 Tax=Medicago truncatula RepID=G7I358_MEDTR	SoyBase	E_val: 4.00E-73	ISS
UniRef100_I1KE22	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE22_SOYBN	SoyBase	E_val: 1.00E-111	ISS

Expression Patterns of Glyma06g39206

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g39206 not represented in the dataset	Glyma06g39206 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g39206 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g251900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g39206

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g39206

Limit To All Plant Sequences

>Glyma06g39206.1   sequence type=CDS   gene model=Glyma06g39206   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCCCTTGTGAAGCAAATGTCTGTAAATCTTAAACGCATTCACAACTTAGGGATAAAAAATGTAGCAGTTGGGTTATTACAGCCAATTGGGTGTTTGCCTGTGTTAAATGTGATATCTTTCCGTACGAACTGCATTGGCCTTTTGAACGTGATCTCCAAAGATCACAACAAAATGTTGCTCAAAGCTGTGCAAGAACTCAACAAGGAAGCAGCAGACAAATCAGTTTTCATGACACTGGACCTCTACAACTCCTTCCTCTCTGCAATTGAAACTATGCAGAAAAAGCGTGCAGAAAAGTCTACACTGATGAATCCGTTGCAACCATGCTGTGAGGGAAACAATTTGGAAGATTCATGTGGAAGTGTGGATGACGAAGGATCAAAGAAATACAGTTTATGTGAGAACCCGAAACTTTCTTTCTTTTGGGACACACTTCACCCTTCTCAAAATGGTTGGTTTGCAGTCTACACCCAATAG

Predicted protein sequences of Glyma06g39206

Limit To All Plant Sequences

>Glyma06g39206.1   sequence type=predicted peptide   gene model=Glyma06g39206   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESLVKQMSVNLKRIHNLGIKNVAVGLLQPIGCLPVLNVISFRTNCIGLLNVISKDHNKMLLKAVQELNKEAADKSVFMTLDLYNSFLSAIETMQKKRAEKSTLMNPLQPCCEGNNLEDSCGSVDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAVYTQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain