SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g39120

Feature Type:gene_model
Chromosome:Gm06
Start:42018403
stop:42019328
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g39120
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20825AT Annotation by Michelle Graham. TAIR10: Developmental regulator, ULTRAPETALA | chr2:8965845-8966795 REVERSE LENGTH=228 SoyBaseE_val: 2.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
UniRef100_B9T641UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein ULTRAPETALA2, putative n=1 Tax=Ricinus communis RepID=B9T641_RICCO SoyBaseE_val: 3.00E-14ISS
UniRef100_I1KE27UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE27_SOYBN SoyBaseE_val: 2.00E-85ISS

Expression Patterns of Glyma06g39120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g39120 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g39120
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g39120
>Glyma06g39120.1   sequence type=CDS   gene model=Glyma06g39120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTGGAAATATGTTCATGATCAAATAAATAGGGCCATCAAAACGAAGAAAGCAATTTCATCACTTGTGAGTGTTGCCCTGAGTGTCCCTTGGGAACTGCAGAATCTGTTGATCTTTTTTAGAGCCTTATTTTTGTTATTTAAAATAGAGAAATCAAGGTGTATGTACAATTTGAGTGTCCAAATATTGGGACTCTTAATAACATGCGATGATGATGAAGAGAGATCAAGTCTGAAAGCAAGCAGGGGCTGTTCTCGTTCTTCAACTTGCCAAGGCTGCTCAACTTGTTACTGTGAAGGGTGCATCAAGTGCCACTTTGAGGATTGCAATTGTCAAGAATGCAGAGACTTTATGCTATATGCTAAACCTTAA
Predicted protein sequences of Glyma06g39120
>Glyma06g39120.1   sequence type=predicted peptide   gene model=Glyma06g39120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAWKYVHDQINRAIKTKKAISSLVSVALSVPWELQNLLIFFRALFLLFKIEKSRCMYNLSVQILGLLITCDDDEERSSLKASRGCSRSSTCQGCSTCYCEGCIKCHFEDCNCQECRDFMLYAKP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo