Glyma06g38935 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38935

Feature Type:	gene_model
Chromosome:	Gm06
Start:	41867774
stop:	41869210
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g38935

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G24260	AT	Annotation by Michelle Graham. TAIR10: LJRHL1-like 1 \| chr2:10319646-10322177 REVERSE LENGTH=350	SoyBase	E_val: 8.00E-19	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0080147	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR16223	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR16223:SF1	Panther	gb def: riken cdna 4933406n12 [mus musculus]	JGI		ISS
UniRef100_B4FMK3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BHLH transcription factor n=2 Tax=Zea mays RepID=B4FMK3_MAIZE	SoyBase	E_val: 9.00E-19	ISS
UniRef100_UPI000233A720	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A720 related cluster n=1 Tax=unknown RepID=UPI000233A720	SoyBase	E_val: 1.00E-29	ISS

Expression Patterns of Glyma06g38935

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38935 not represented in the dataset	Glyma06g38935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g38935 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g251200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g38935

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g38935

Limit To All Plant Sequences

>Glyma06g38935.1   sequence type=CDS   gene model=Glyma06g38935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTACTACTGTTCCTACTGCTCCACATCCACCAGCAGTGCGACCTAGAGTGCGGGCTAGAAGAGGACAGACTACAGATCCGCATAGTATAGCTGAAAGGTTGCACAGAGAGAGAATAGCAGAAAGAATCAGGGCTTTGCAAGAACTGGTCCCTAGTGTCAACAAGGTATTTGAATTCTTGGACATGACATTTTATTACTACATGTAG

Predicted protein sequences of Glyma06g38935

Limit To All Plant Sequences

>Glyma06g38935.1   sequence type=predicted peptide   gene model=Glyma06g38935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPTTVPTAPHPPAVRPRVRARRGQTTDPHSIAERLHRERIAERIRALQELVPSVNKVFEFLDMTFYYYM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain