Glyma06g38761 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38761): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38761): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38761

Feature Type:	gene_model
Chromosome:	Gm06
Start:	41783626
stop:	41787845
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g38761

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01910	AT	Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein \| chr1:313746-315831 REVERSE LENGTH=303	SoyBase	E_val: 6.00E-19	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006891	GO-bp	Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0043248	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome assembly	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0071722	GO-bp	Annotation by Michelle Graham. GO Biological Process: detoxification of arsenic-containing substance	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
UniRef100_B9RDI9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Arsenical pump-driving atpase, putative n=1 Tax=Ricinus communis RepID=B9RDI9_RICCO	SoyBase	E_val: 5.00E-17	ISS
UniRef100_UPI0002339E80	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339E80 related cluster n=1 Tax=unknown RepID=UPI0002339E80	SoyBase	E_val: 1.00E-53	ISS

Expression Patterns of Glyma06g38761

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38761 not represented in the dataset	Glyma06g38761 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g38761 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g38761

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g38761

Limit To All Plant Sequences

>Glyma06g38761.1   sequence type=CDS   gene model=Glyma06g38761   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGTGGATCCTACTGTTGAGCATGAGGACATGGGTGGCGCTGATGGGATGGACTCCTTGTTCTCCGAGCTCGCCGGCGCGATTCCCAGGATTGATGAGGCCATGAGCTTTGCTGAGATGTTGAAGGCTATTGCAATGGAAGGAACAGAAAACAGAGTCTCATTACTGACTATCCACTCAAAGACACTGCATTTTGATACCTGTGGAACTGCAAAGAGTACTTGGATAAGGCAGTTCACATTATCCTGA

Predicted protein sequences of Glyma06g38761

Limit To All Plant Sequences

>Glyma06g38761.1   sequence type=predicted peptide   gene model=Glyma06g38761   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVDPTVEHEDMGGADGMDSLFSELAGAIPRIDEAMSFAEMLKAIAMEGTENRVSLLTIHSKTLHFDTCGTAKSTWIRQFTLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain