Glyma06g38425 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38425): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38425): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38425

Feature Type:	gene_model
Chromosome:	Gm06
Start:	41342426
stop:	41343757
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g38425

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12120	AT	Annotation by Michelle Graham. TAIR10: fatty acid desaturase 2 \| chr3:3860592-3861743 REVERSE LENGTH=383	SoyBase	E_val: 9.00E-68	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0016717	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water	SoyBase	N/A	ISS
GO:0016720	GO-mf	Annotation by Michelle Graham. GO Molecular Function: delta12-fatty acid dehydrogenase activity	SoyBase	N/A	ISS
GO:0045485	GO-mf	Annotation by Michelle Graham. GO Molecular Function: omega-6 fatty acid desaturase activity	SoyBase	N/A	ISS
PTHR19353	Panther	FATTY ACID DESATURASE 2	JGI		ISS
PF00487	PFAM	Fatty acid desaturase	JGI		ISS
UniRef100_C6TI10	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TI10_SOYBN	SoyBase	E_val: 4.00E-80	ISS
UniRef100_Q5FB99	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Microsomal omega-6 fatty acid desaturase n=1 Tax=Glycine max RepID=Q5FB99_SOYBN	SoyBase	E_val: 5.00E-79	ISS

Expression Patterns of Glyma06g38425

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38425 not represented in the dataset	Glyma06g38425 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g38425 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g38425

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g38425

Limit To All Plant Sequences

>Glyma06g38425.1   sequence type=CDS   gene model=Glyma06g38425   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGCCTTCTGCCTCTATTATGTTGCCACCCATTACTTCCACGTCCTTCCCAGCCCTTTCTCTTTCTTGGCATGGCCAATCTACTGGGCTGTCCAAGGTTGCATCCTTACTGGAGTTTGGGTCATTGCCCATGAGTGTGGCCACCATGCATTCAGTGAATACCAGTTGCTTGATGATATTGTTGGCCTTGTCCTCCACTCCGGTCTCCTAGTCCCATACTTTTCATGGAAATACAGCCATCGCCATCACCACTCCAACACTGGTTCTCTTGAGCGGGATGAAGTATTTGTGCCAAAGCAGAAGTCCTGTATCAAGTGGTACTCTAAATACCTTAACAATCCTCCAGGCAGAGTCCTCACTCTTACCGTATTCTATTATTATTGA

Predicted protein sequences of Glyma06g38425

Limit To All Plant Sequences

>Glyma06g38425.1   sequence type=predicted peptide   gene model=Glyma06g38425   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAFCLYYVATHYFHVLPSPFSFLAWPIYWAVQGCILTGVWVIAHECGHHAFSEYQLLDDIVGLVLHSGLLVPYFSWKYSHRHHHSNTGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLTVFYYY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain