SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g38410

Feature Type:gene_model
Chromosome:Gm06
Start:41306757
stop:41309130
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g38410
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27410AT Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein | chr4:13707928-13709013 REVERSE LENGTH=297 SoyBaseE_val: 7.00E-116ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF02365PFAM No apical meristem (NAM) protein JGI ISS
UniRef100_I1KE01UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE01_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q52QR3UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein NAC3 n=1 Tax=Glycine max RepID=Q52QR3_SOYBN SoyBaseE_val: 0ISS

Proteins Associated with Glyma06g38410
LocusGene SymbolProtein Name
NAC043 NAC Transcription Factor gene 43

Expression Patterns of Glyma06g38410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g38410
ParalogEvidenceComments
Glyma12g22880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g38410 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g248900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g38410
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g38410
>Glyma06g38410.1   sequence type=CDS   gene model=Glyma06g38410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGTTCCAGAGAGAGACCCTCTTGCACAATTGAGTTTGCCTCCTGGGTTTAGGTTTTACCCCACAGATGAGGAGCTTTTGGTTCAGTACCTTTGCCGCAAGGTTGCTGGCCATCATTTCTCTCTTCCAATCATTGCTGAAGTTGATTTGTACAAGTTTGATCCATGGGTTCTTCCAGGTAAGGCAGTGTTTGGAGAGAAGGAGTGGTACTTTTTTAGCCCAAGAGACAGGAAGTACCCGAATGGTTCACGACCAAACAGAGTCGCGGGTTCTGGGTATTGGAAAGCAACTGGAACAGACAAGATCATCACCACTGAAGGTAGAAAAGTTGGCATAAAAAAAGCACTTGTTTTCTACATTGGCAAAGCACCCAAAGGCTCCAAAACCAATTGGATCATGCACGAGTATCGCCTTCTCGATTCTTCCCGCAAACACAACCTCGGAACCGCAAAGCTTGATGATTGGGTTCTATGTCGTATCTATAAGAAGAACTCAAGTTCACAAAAGGTTGAGGCTAATTTTTTGGCTATGGAATGCAGCAATGGGTCATCACCTTCTTCATCGTCCCACGTGGATGACATGCTGGGATCGTTGCCGGAGATAAATGACCGGTGCTTCACCCTGCCACGAGTGAACTCACTCAGAACAATGCACCAGCAGGATGAGAAATTCGGGTCTCCGAACATGGGATCCGGGTTTTTCTCGGATTGGGTTAACTCGACCGATCTCGATTCGATTTCCGAATTCGAGTCGGGTTGCCAAACCCAAAGAATGGTGAATTATGATTGCAATGACTTTTTTGTTCCTTCTCTGCCGCCCTTGGGCCATGTGGACTACATGGTGGATGCACCTTTGGAGGAGGAGGTTCAAAGTGGTGTGAGAACCCGACGGGTCGACGGGCCGGGGCATTTTCAACCGAATCCAGATACCCGATTGTTACCGGGCTCAGGTGACCCATTCGGGTTTGGGTTTATTATGGGTCAGCAAGTTGGGTTCGGGGTTAGGGAGTGA
Predicted protein sequences of Glyma06g38410
>Glyma06g38410.1   sequence type=predicted peptide   gene model=Glyma06g38410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVPERDPLAQLSLPPGFRFYPTDEELLVQYLCRKVAGHHFSLPIIAEVDLYKFDPWVLPGKAVFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITTEGRKVGIKKALVFYIGKAPKGSKTNWIMHEYRLLDSSRKHNLGTAKLDDWVLCRIYKKNSSSQKVEANFLAMECSNGSSPSSSSHVDDMLGSLPEINDRCFTLPRVNSLRTMHQQDEKFGSPNMGSGFFSDWVNSTDLDSISEFESGCQTQRMVNYDCNDFFVPSLPPLGHVDYMVDAPLEEEVQSGVRTRRVDGPGHFQPNPDTRLLPGSGDPFGFGFIMGQQVGFGVRE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo