SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38365

Feature Type:gene_model
Chromosome:Gm06
Start:41203111
stop:41204070
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g38365
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G14830AT Annotation by Michelle Graham. TAIR10: Regulator of Vps4 activity in the MVB pathway protein | chr2:6362524-6365818 FORWARD LENGTH=454 SoyBaseE_val: 1.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR12161Panther UNCHARACTERIZED DUF292 JGI ISS
PTHR12161:SF4Panther gb def: agcp6260 [anopheles gambiae str. pest] JGI ISS
PF03398PFAM Regulator of Vps4 activity in the MVB pathway JGI ISS
UniRef100_G7JSJ0UniRef Annotation by Michelle Graham. Most informative UniRef hit: IST1-like protein n=1 Tax=Medicago truncatula RepID=G7JSJ0_MEDTR SoyBaseE_val: 7.00E-20ISS
UniRef100_I1KDZ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KDZ7_SOYBN SoyBaseE_val: 2.00E-104ISS

Expression Patterns of Glyma06g38365
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38365 not represented in the dataset
Glyma06g38365 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g38365
ParalogEvidenceComments
Glyma12g22960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g38365 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g248400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g38365
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g38365
>Glyma06g38365.1   sequence type=CDS   gene model=Glyma06g38365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAATTTCAAGCTCAATTAATTATCCAGAAAAATAGAAGGCATGTTATTATCAACCAATCACGTGAAGATATTGTTCAGTTGCTCCAAATTGATAAGTTAGAGGGTGCTTTTTCTAGGGTTGATCAGCTGTATAAAGACACATGTTTGTTGACTGCATATGATCTAATTGATAATTTCTGTGAATGCATCATCTCCAACATGTCCTTCATTAGCAAATGCAGTTCTGTACACAACTTGTCTACAAATGTTGTTGTGGCAATTGCAAGTCTCACATATGCTTCTTCAAGATGTGGTGAATTGCCACTTTTGCATCTGATAAGAAACTTGTTCAGAGAGAGATATGGTAGGGATTTTGACATTACCAATGTGGAACTATTTGCTGGAAACTATGTGGACTTGCCGTTGAGGAAAAACCTGAGCATCTATAGTGTACCAGAAGACGAGAAACTCATGTTATTAAATGATATAGCTCTAGAAAACTTCAACAAAGAACTTGAGATACTATGA
Predicted protein sequences of Glyma06g38365
>Glyma06g38365.1   sequence type=predicted peptide   gene model=Glyma06g38365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQFQAQLIIQKNRRHVIINQSREDIVQLLQIDKLEGAFSRVDQLYKDTCLLTAYDLIDNFCECIISNMSFISKCSSVHNLSTNVVVAIASLTYASSRCGELPLLHLIRNLFRERYGRDFDITNVELFAGNYVDLPLRKNLSIYSVPEDEKLMLLNDIALENFNKELEIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo