Glyma06g38270 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38270

Feature Type:	gene_model
Chromosome:	Gm06
Start:	41138119
stop:	41138805
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g38270

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G14740	AT	Annotation by Michelle Graham. TAIR10: vaculolar sorting receptor 3 \| chr2:6308895-6312303 FORWARD LENGTH=628	SoyBase	E_val: 5.00E-45	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0005887	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0017119	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi transport complex	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
PTHR22765	Panther	RING FINGER AND PROTEASE ASSOCIATED DOMAIN-CONTAINING	JGI		ISS
PTHR22765:SF8	Panther	VSR-2 (VACUOLAR SORTING RECEPTOR 2), CALCIUM ION B	JGI		ISS
UniRef100_G7K0X0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar-sorting receptor n=1 Tax=Medicago truncatula RepID=G7K0X0_MEDTR	SoyBase	E_val: 8.00E-46	ISS
UniRef100_I1LFP5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LFP5_SOYBN	SoyBase	E_val: 3.00E-49	ISS

Expression Patterns of Glyma06g38270

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38270 not represented in the dataset	Glyma06g38270 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g38270 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g38270

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g38270

Limit To All Plant Sequences

>Glyma06g38270.1   sequence type=CDS   gene model=Glyma06g38270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTAATATCGAAAAGATTGAAAAGTGCATGGGAGATCCAGATGCCAATACTGATAATCCTATTGGAAAGGGATCGCGAGGTGATGTTACCATATTGCCTACTCTTGTTAAAGGTGTTGTTCTAAAGGCTATATGTTATGGGTTTGAGGAAACTACTGAACCAGCTATTTGCTTGAGCAGTGGCAAGTATGTGGAGACAAATGAGTGCTTGACAAACAATGGTGGTTGCTGGCAGGATAAAGCAGCTAACATCACTGCTTGCAAGGATACATTCCATGGGAGAGTATGTGAATGCCCTCTGGTTGATGGT

Predicted protein sequences of Glyma06g38270

Limit To All Plant Sequences

>Glyma06g38270.1   sequence type=predicted peptide   gene model=Glyma06g38270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LNIEKIEKCMGDPDANTDNPIGKGSRGDVTILPTLVKGVVLKAICYGFEETTEPAICLSSGKYVETNECLTNNGGCWQDKAANITACKDTFHGRVCECPLVDG

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain