Glyma06g38237 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38237): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38237): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38237

Feature Type:	gene_model
Chromosome:	Gm06
Start:	41082520
stop:	41084411
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g38237

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G67580	AT	Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein \| chr1:25327727-25330965 REVERSE LENGTH=752	SoyBase	E_val: 1.00E-57	ISS
GO:0000956	GO-bp	Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process	SoyBase	N/A	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0009887	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ morphogenesis	SoyBase	N/A	ISS
GO:0009888	GO-bp	Annotation by Michelle Graham. GO Biological Process: tissue development	SoyBase	N/A	ISS
GO:0010638	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization	SoyBase	N/A	ISS
GO:0033044	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24056	Panther	CELL DIVISION PROTEIN KINASE	JGI		ISS
PTHR24056:SF86	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_B9RML9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cdk10/11, putative n=1 Tax=Ricinus communis RepID=B9RML9_RICCO	SoyBase	E_val: 7.00E-57	ISS
UniRef100_UPI000233955E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233955E related cluster n=1 Tax=unknown RepID=UPI000233955E	SoyBase	E_val: 6.00E-59	ISS

Expression Patterns of Glyma06g38237

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38237 not represented in the dataset	Glyma06g38237 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g38237 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g247800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g38237

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma06g38237

Limit To All Plant Sequences

>Glyma06g38237.2   sequence type=transcript   gene model=Glyma06g38237   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTCTTCTTAAGACAAAACAATAGTTCAACAGCCATTGACATATGGTCTCTGGGTTGTATAATGGTTGAGCTATTGTCCAAGGAATCACTGTTTAATGGGAAGACTGAATTTGAACAACTTGACAAGATTTTTAGAATTCTTGGCACACCAAATGAAACAATTTGGCTTGGGTTCTCAGAATTACCCCAAGTCAAGGTCAATTTTGTTAAGAATAAGTATAATCTCCTGCACAAAAAATTTCCCGTAACATCATTCACCGGATCACCAGTTCTTTTCGATTTGTTGAACAAGCTTTTAACTTATGACCATGAAAAGTTTTGTGAAGTTCCCCATCCGAAGTCTAAAGAATTTATGCCTACATTCCCTGCTCAACATGCTTAG

Coding sequences of Glyma06g38237

Limit To All Plant Sequences

>Glyma06g38237.1   sequence type=CDS   gene model=Glyma06g38237   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCGGACATCATTCCCTGGCAATGGAAGAGATCATTTAGTTAATAATGCCATTGACATATGGTCTCTGGGTTGTATAATGGTTGAGCTATTGTCCAAGGAATCACTGTTTAATGGGAAGACTGAATTTGAACAACTTGACAAGATTTTTAGAATTCTTGGCACACCAAATGAAACAATTTGGCTTGGGTTCTCAGAATTACCCCAAGTCAAGGTCAATTTTGTTAAGAATAAGTATAATCTCCTGCACAAAAAATTTCCCGTAACATCATTCACCGGATCACCAGTTCTTTTCGATTTGTTGAACAAGCTTTTAACTTATGACCATGAAAAGTTTTGTGAAGTTCCCCATCCGAAGTCTAAAGAATTTATGCCTACATTCCCTGCTCAACATGCTTAG

>Glyma06g38237.2   sequence type=CDS   gene model=Glyma06g38237   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAGCTATTGTCCAAGGAATCACTGTTTAATGGGAAGACTGAATTTGAACAACTTGACAAGATTTTTAGAATTCTTGGCACACCAAATGAAACAATTTGGCTTGGGTTCTCAGAATTACCCCAAGTCAAGGTCAATTTTGTTAAGAATAAGTATAATCTCCTGCACAAAAAATTTCCCGTAACATCATTCACCGGATCACCAGTTCTTTTCGATTTGTTGAACAAGCTTTTAACTTATGACCATGAAAAGTTTTGTGAAGTTCCCCATCCGAAGTCTAAAGAATTTATGCCTACATTCCCTGCTCAACATGCTTAG

Predicted protein sequences of Glyma06g38237

Limit To All Plant Sequences

>Glyma06g38237.1   sequence type=predicted peptide   gene model=Glyma06g38237   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRTSFPGNGRDHLVNNAIDIWSLGCIMVELLSKESLFNGKTEFEQLDKIFRILGTPNETIWLGFSELPQVKVNFVKNKYNLLHKKFPVTSFTGSPVLFDLLNKLLTYDHEKFCEVPHPKSKEFMPTFPAQHA*

>Glyma06g38237.2   sequence type=predicted peptide   gene model=Glyma06g38237   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVELLSKESLFNGKTEFEQLDKIFRILGTPNETIWLGFSELPQVKVNFVKNKYNLLHKKFPVTSFTGSPVLFDLLNKLLTYDHEKFCEVPHPKSKEFMPTFPAQHA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain