|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G11910 | AT | Annotation by Michelle Graham. TAIR10: ubiquitin-specific protease 13 | chr3:3761758-3770290 REVERSE LENGTH=1114 | SoyBase | E_val: 9.00E-11 | ISS |
GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0009630 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gravitropism | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0004221 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ubiquitin thiolesterase activity | SoyBase | N/A | ISS |
GO:0004843 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ubiquitin-specific protease activity | SoyBase | N/A | ISS |
UniRef100_G8A1Y1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carboxyl-terminal hydrolase family protein n=1 Tax=Medicago truncatula RepID=G8A1Y1_MEDTR | SoyBase | E_val: 2.00E-09 | ISS |
UniRef100_I1LXZ0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LXZ0_SOYBN | SoyBase | E_val: 2.00E-09 | ISS |
Glyma06g38212 not represented in the dataset |
Glyma06g38212 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.06g247600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g38212.1 sequence type=CDS gene model=Glyma06g38212 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGGAGTTTTGCCCCAAAAAGTTTCAATTTTTTAGAACAAGCACATTCACGGAGAAGGGATATATATGGTGCTTGGGAGCAATATCTTGGACTGGAACATGATGACAGTGCTCCAAAAAAGTCCTATGCAGTCAACGAGGAAATAAATTGTTGCTTTGTTGAGTGGATGTGTAAGTTGAGGTGCAATATCAACAAAAGGTGGGTGTGTAACTCGAGGTGCAATATCAACAAAATCTTTGTGCTAGCTGAACTCCATATTATCCACGACCATGGTTCATAA
>Glyma06g38212.1 sequence type=predicted peptide gene model=Glyma06g38212 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRSFAPKSFNFLEQAHSRRRDIYGAWEQYLGLEHDDSAPKKSYAVNEEINCCFVEWMCKLRCNINKRWVCNSRCNINKIFVLAELHIIHDHGS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||