SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g38190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g38190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g38190

Feature Type:gene_model
Chromosome:Gm06
Start:41032267
stop:41034085
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g38190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15520AT Annotation by Michelle Graham. TAIR10: tRNA/rRNA methyltransferase (SpoU) family protein | chr4:8862829-8864366 FORWARD LENGTH=222 SoyBaseE_val: 1.00E-29ISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0008173GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA methyltransferase activity SoyBaseN/AISS
PTHR13032Panther FAMILY NOT NAMED JGI ISS
PTHR13032:SF6Panther SUBFAMILY NOT NAMED JGI ISS
PF00588PFAM SpoU rRNA Methylase family JGI ISS
UniRef100_G7JHW1UniRef Annotation by Michelle Graham. Most informative UniRef hit: tRNA guanosine-2'-O-methyltransferase n=1 Tax=Medicago truncatula RepID=G7JHW1_MEDTR SoyBaseE_val: 6.00E-34ISS
UniRef100_I1KDZ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDZ1_SOYBN SoyBaseE_val: 9.00E-131ISS

Expression Patterns of Glyma06g38190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g38190 not represented in the dataset
Glyma06g38190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g38190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g247300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g38190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g38190
>Glyma06g38190.1   sequence type=CDS   gene model=Glyma06g38190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGAGGAGGAATCAATAGTGGTTCTAGTTGAGGACGAAGATGATCCTTCATCGACGCTTCTGGATCTCACGAACGCTTGCAACTTCCTCAAAGACAAAGACTGTGATATTTGTGGCATTGAGATCACAAATGATGCTCTCCCTATCAATCAACATCCTTTCAACAAGAGCACTGCATTCCTACTCGGCAACGAGGGTACTGACCTTTCTCCTAAGGAAATTGAGATATGCGATTCTTTCGACTATATCCTGCAATATGGCGGTGACACTGCTTCCTTGAATGTTACTATAGCTACTTCCATTGTAAGGATGAAGATTGGATTTCCAATTACTAGTTATGGTCAGGAGAGTAGAAATAGAGTTGCTCGCCAAAGAATTCCTCACAGGGTATGGACTGATGAGGAAGGTGTTGAGCATGTGGAGCTAGCTCGGACTGGGATAATTAGAGAAATAAGGCATTTGCCTCTAAATAAGAAAAAGGGTACTGAGAATCAAAAAGGAGGTGGTGGGACCTTATCAAGTTGGAAACATTTGGACTCTTAG
Predicted protein sequences of Glyma06g38190
>Glyma06g38190.1   sequence type=predicted peptide   gene model=Glyma06g38190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKEEESIVVLVEDEDDPSSTLLDLTNACNFLKDKDCDICGIEITNDALPINQHPFNKSTAFLLGNEGTDLSPKEIEICDSFDYILQYGGDTASLNVTIATSIVRMKIGFPITSYGQESRNRVARQRIPHRVWTDEEGVEHVELARTGIIREIRHLPLNKKKGTENQKGGGGTLSSWKHLDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo