|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G22910 | AT | Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr1:8105808-8107618 FORWARD LENGTH=242 | SoyBase | E_val: 6.00E-38 | ISS |
GO:0000398 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0005575 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cellular component | SoyBase | N/A | ISS |
GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
PTHR24011 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR24011:SF26 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
UniRef100_B9R8Y3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: RNA-binding region-containing protein, putative n=1 Tax=Ricinus communis RepID=B9R8Y3_RICCO | SoyBase | E_val: 5.00E-42 | ISS |
UniRef100_I1L5T4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L5T4_SOYBN | SoyBase | E_val: 1.00E-43 | ISS |
Glyma06g37845 not represented in the dataset |
Glyma06g37845 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g37845.1 sequence type=CDS gene model=Glyma06g37845 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGAAGTATTTTGAGCAATTTGGTGAGATCTTAGAGGCTGTTGTCATCACTGACAAAGCCACTGGAAGATGTAAAGGCTATGGATTTGTTACTTTTCGTGAACCAGAAGCTTCCATGAGAGCTTGTGTGGATCCTGCTCCTATAATCAACGGTAGGAGCGCTAACTGCAACCTTGCTTCTTTGGGTGTCCAGAGATCTAAGCCTTCAACCCCAAAACATGCTAATCTATAA
>Glyma06g37845.1 sequence type=predicted peptide gene model=Glyma06g37845 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKKYFEQFGEILEAVVITDKATGRCKGYGFVTFREPEASMRACVDPAPIINGRSANCNLASLGVQRSKPSTPKHANL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||