SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G46370 | AT | Annotation by Michelle Graham. TAIR10: Auxin-responsive GH3 family protein | chr2:19034233-19036369 FORWARD LENGTH=586 | SoyBase | E_val: 2.00E-43 | ISS |
| GO:0009585 | GO-bp | Annotation by Michelle Graham. GO Biological Process: red, far-red light phototransduction | SoyBase | N/A | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009694 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid metabolic process | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
| GO:0009861 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid and ethylene-dependent systemic resistance | SoyBase | N/A | ISS |
| GO:0009864 | GO-bp | Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010046 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to mycotoxin | SoyBase | N/A | ISS |
| GO:0010119 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement | SoyBase | N/A | ISS |
| GO:0010193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ozone | SoyBase | N/A | ISS |
| GO:0010224 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to UV-B | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0071365 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to auxin stimulus | SoyBase | N/A | ISS |
| GO:2000030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of response to red or far red light | SoyBase | N/A | ISS |
| GO:2000377 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of reactive oxygen species metabolic process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0019899 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: enzyme binding | SoyBase | N/A | ISS |
| GO:0070566 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: adenylyltransferase activity | SoyBase | N/A | ISS |
| GO:0080123 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: jasmonate-amino synthetase activity | SoyBase | N/A | ISS |
| PF03321 | PFAM | GH3 auxin-responsive promoter | JGI | ISS | |
| UniRef100_G7L419 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: GH3 family protein n=1 Tax=Medicago truncatula RepID=G7L419_MEDTR | SoyBase | E_val: 1.00E-60 | ISS |
| UniRef100_UPI000233A5B4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A5B4 related cluster n=1 Tax=unknown RepID=UPI000233A5B4 | SoyBase | E_val: 5.00E-82 | ISS |
|
Glyma06g37401 not represented in the dataset |
Glyma06g37401 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g243500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g37401.1 sequence type=CDS gene model=Glyma06g37401 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAAGAAAGAGTTCAGAGGGAAACACTCAAGAGGATTTTGGAGGATAACGCATCAGCAGAGTACTTGCAGAGTTTGGGTCTCAATGGAAGAACTGACCCTGAGAGTTTCAAGGCCTGTGTTCCAATGGTCACCCACAAAGAATTGGAACCTTATATCTACAGAATTATTGATGGTGATGCTTCTCCTATTCTCACTGGAAAACCCATCACAACCATGTCCTTAAGTTCTGGCACTACCCAGGGGAAACCAAAGTATGTACCTTGGAATGATGAATTGTATGAAACCACAATGCAGATATACCAGACCTCTTTTGCCTTTAGAAACAGGGAGTTTCCTATAATGTTGTGGTGA
>Glyma06g37401.1 sequence type=predicted peptide gene model=Glyma06g37401 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQERVQRETLKRILEDNASAEYLQSLGLNGRTDPESFKACVPMVTHKELEPYIYRIIDGDASPILTGKPITTMSLSSGTTQGKPKYVPWNDELYETTMQIYQTSFAFRNREFPIMLW*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
