Glyma06g37340 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g37340

Feature Type:	gene_model
Chromosome:	Gm06
Start:	39748270
stop:	39749181
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g37340

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G56630	AT	Annotation by Michelle Graham. TAIR10: phosphofructokinase 7 \| chr5:22924311-22926728 FORWARD LENGTH=485	SoyBase	E_val: 1.00E-12	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005945	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: 6-phosphofructokinase complex	SoyBase	N/A	ISS
GO:0003872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 6-phosphofructokinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
UniRef100_C1K4P9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phosphofructokinase (Fragment) n=1 Tax=Elaeis oleifera RepID=C1K4P9_ELAOL	SoyBase	E_val: 2.00E-10	ISS
UniRef100_I1KKR9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KKR9_SOYBN	SoyBase	E_val: 3.00E-25	ISS

Expression Patterns of Glyma06g37340

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g37340 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g243200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g37340

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g37340

Limit To All Plant Sequences

>Glyma06g37340.1   sequence type=CDS   gene model=Glyma06g37340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTGCACTGCAGAACTTATTGTGCTGCAAATTCGTTGCCCTGCTTGATATTGTTGGTTCTGCTTCTCCAACATAGATATGATTTATTTGTTAAGAATAGAATCACTCAGGGACAGAACAAAGTGCTAATTACTGATAGAATGTGGGCTAGGCTTCTATCTTCAACAAATCTGCCCAGCTTTACGATTGCTAAGACTGTCTCTGAAGAAAAAAGGGAAGAAGAAGCAAACGGTAATGTCCCTGAGTAA

Predicted protein sequences of Glyma06g37340

Limit To All Plant Sequences

>Glyma06g37340.1   sequence type=predicted peptide   gene model=Glyma06g37340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALHCRTYCAANSLPCLILLVLLLQHRYDLFVKNRITQGQNKVLITDRMWARLLSSTNLPSFTIAKTVSEEKREEEANGNVPE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain