Glyma06g37250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g37250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g37250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g37250

Feature Type:	gene_model
Chromosome:	Gm06
Start:	39702515
stop:	39706810
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g37250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G15352	AT	Annotation by Michelle Graham. TAIR10: cytochrome c oxidase 17 \| chr3:5180266-5180490 FORWARD LENGTH=74	SoyBase	E_val: 2.00E-30	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0006825	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transport	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0046688	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to copper ion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0016531	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper chaperone activity	SoyBase	N/A	ISS
KOG3496	KOG	Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17	JGI		ISS
PTHR16719	Panther	CYTOCHROME C OXIDASE COPPER CHAPERONE	JGI		ISS
PF05051	PFAM	Cytochrome C oxidase copper chaperone (COX17)	JGI		ISS
UniRef100_B9T0E6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase copper chaperone, putative n=1 Tax=Ricinus communis RepID=B9T0E6_RICCO	SoyBase	E_val: 1.00E-35	ISS
UniRef100_I1KDW4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDW4_SOYBN	SoyBase	E_val: 5.00E-51	ISS

Expression Patterns of Glyma06g37250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g37250 not represented in the dataset	Glyma06g37250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g37250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g242800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g37250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma06g37250

Limit To All Plant Sequences

>Glyma06g37250.2   sequence type=transcript   gene model=Glyma06g37250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTTAAATAAGTTGTAGAAGAAAACACCAGAAGAATCGTCTCTCTGTCTGGTCCATTGTACGACTTGCACGCAGAGGCAAGACTCGCAGCCAGGATTGTTCTGCTGCATAAAATCTTGGTTCTAGTTCATGTATTCAGATATAAGACAATGAGTGGTGCGCAACTGCAAAGTGCTTCCCCTGCCTTGACCATACAAGGGTCACAGAAAAATGTAGGTTCGGTGGCTGTGGCAACTGCTGCAGAATCAAAGCCAAAGAAGAAAATCTGCTGTGCTTGCCCAGACACTAAAAGGTTGCGAGATGAATGCATAGTAGAGCATGGTGAATCAGCCTGTACAAAATGGATTGAGGCTCATCGACTGTGCCTCCGTGCTGAGGGATTCAATGTTTGAGGTTGATAGTGAGGAAAAGACATTAGTAGATTAACTCAGTTGATTTTATGAAATTGATAGAAGATTTTGGGTTGCAATTTTCAGGTTGACAGTTTAAATTTTGAATAAAAGCTGGGAAATTGATTGCTACGTAATTTGTTACCTTTTAACTTTTTAAACCAGCAGGTTCTACACTGTTAGTTTTGTTGAGACTGAAATATTTAAATGAAATTACAAATTGTCATATTGTCACTTTCCTGCT

Coding sequences of Glyma06g37250

Limit To All Plant Sequences

>Glyma06g37250.1   sequence type=CDS   gene model=Glyma06g37250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGGTGCGCAACTGCAAAGTGCTTCCCCTGCCTTGACCATACAAGGGTCACAGAAAAATGTAGGTTCGGTGGCTGTGGCAACTGCTGCAGAATCAAAGCCAAAGAAGAAAATCTGCTGTGCTTGCCCAGACACTAAAAGGTTGCGAGATGAATGCATAGTAGAGCATGGTGAATCAGCCTGTACAAAATGGATTGAGGCTCATCGACTGTGCCTCCGTGCTGAGGGATTCAATGTTTGA

>Glyma06g37250.2   sequence type=CDS   gene model=Glyma06g37250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGGTGCGCAACTGCAAAGTGCTTCCCCTGCCTTGACCATACAAGGGTCACAGAAAAATGTAGGTTCGGTGGCTGTGGCAACTGCTGCAGAATCAAAGCCAAAGAAGAAAATCTGCTGTGCTTGCCCAGACACTAAAAGGTTGCGAGATGAATGCATAGTAGAGCATGGTGAATCAGCCTGTACAAAATGGATTGAGGCTCATCGACTGTGCCTCCGTGCTGAGGGATTCAATGTTTGA

Predicted protein sequences of Glyma06g37250

Limit To All Plant Sequences

>Glyma06g37250.1   sequence type=predicted peptide   gene model=Glyma06g37250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGAQLQSASPALTIQGSQKNVGSVAVATAAESKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHRLCLRAEGFNV*

>Glyma06g37250.2   sequence type=predicted peptide   gene model=Glyma06g37250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGAQLQSASPALTIQGSQKNVGSVAVATAAESKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHRLCLRAEGFNV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain