SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g37175): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g37175): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g37175

Feature Type:gene_model
Chromosome:Gm06
Start:39609102
stop:39614456
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27530AT Annotation by Michelle Graham. TAIR10: golgin candidate 6 | chr3:10193778-10199659 REVERSE LENGTH=914 SoyBaseE_val: 2.00E-50ISS
GO:0000956GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process SoyBaseN/AISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0007033GO-bp Annotation by Michelle Graham. GO Biological Process: vacuole organization SoyBaseN/AISS
GO:0009639GO-bp Annotation by Michelle Graham. GO Biological Process: response to red or far red light SoyBaseN/AISS
GO:0009791GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic development SoyBaseN/AISS
GO:0032527GO-bp Annotation by Michelle Graham. GO Biological Process: protein exit from endoplasmic reticulum SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0048280GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle fusion with Golgi apparatus SoyBaseN/AISS
GO:0000139GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005795GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi stack SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
PTHR10013Panther VESICLE DOCKING PROTEIN P115 JGI ISS
UniRef100_B9S666UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vesicle docking protein P115, putative n=1 Tax=Ricinus communis RepID=B9S666_RICCO SoyBaseE_val: 1.00E-50ISS
UniRef100_I1N5K6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5K6_SOYBN SoyBaseE_val: 2.00E-72ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g37175 not represented in the dataset

Glyma06g37175 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g37175.1   sequence type=CDS   gene model=Glyma06g37175   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATAAACAGAAAAATAAGACTACTCTGAAAAAGGTGTTGGACCATTTGTTAATATTAGGTGTTGAAAGCCAATGGGTACCTGTTCCCATTTGTTGTGCGGCAATGCAATGCATTGGTGATTTGATTGTTGGAGATTCAAAGAATCGTGATCTTCTTGCTAGCAAAGTTCTAAGAGAGGAGCCACACGTTGAACCTACTCTGAACTCTATACTTAGAATCCTTTTGAGAACTTCTAGCATGCAAGAGTTCATTGTTGCTGATTATATTTTCAAAAGCTTTTGTAAGAAAAATGATGATGGCCAATCAATACTGGCGTCTACGCTAATTCCACAACCATATTCCATGAATCATGTATTCCTCAAGGAGGATGTCAATATGCCTTTTGGCAGCAACATAATCCTCTTCGCTGTTCTTCCATTCGATCAACCCGACGATGCACGTGGACGACTCTTCTTACGGCTCGAAGTTCCTCTGAATCAAGGAGTTCGTGAAGAGCAAGGCTTTCTCCACGGTCCTTACAGCTAG

>Glyma06g37175.1   sequence type=predicted peptide   gene model=Glyma06g37175   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNKQKNKTTLKKVLDHLLILGVESQWVPVPICCAAMQCIGDLIVGDSKNRDLLASKVLREEPHVEPTLNSILRILLRTSSMQEFIVADYIFKSFCKKNDDGQSILASTLIPQPYSMNHVFLKEDVNMPFGSNIILFAVLPFDQPDDARGRLFLRLEVPLNQGVREEQGFLHGPYS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo