SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g37151

Feature Type:gene_model
Chromosome:Gm06
Start:39600071
stop:39600778
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g37151
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G52560AT Annotation by Michelle Graham. TAIR10: UDP-sugar pyrophosphorylase | chr5:21331230-21334573 FORWARD LENGTH=614 SoyBaseE_val: 1.00E-45ISS
GO:0006011GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-glucose metabolic process SoyBaseN/AISS
GO:0009226GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide-sugar biosynthetic process SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0033356GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-L-arabinose metabolic process SoyBaseN/AISS
GO:0046398GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-glucuronate metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0052573GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-D-galactose metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0090406GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube SoyBaseN/AISS
GO:0003983GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP:glucose-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0010491GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP:arabinose-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0016779GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotidyltransferase activity SoyBaseN/AISS
GO:0017103GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP:galactose-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0047338GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP:xylose-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0047350GO-mf Annotation by Michelle Graham. GO Molecular Function: glucuronate-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0051748GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP-monosaccharide-1-phosphate uridylyltransferase activity SoyBaseN/AISS
PTHR11952Panther UDP- GLUCOSE PYROPHOSPHORYLASE JGI ISS
PTHR11952:SF2Panther UDP-N-ACTEYLGLUCOSAMINE PYROPHOSPHORYLASE 1 JGI ISS
UniRef100_I1KAF3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KAF3_SOYBN SoyBaseE_val: 1.00E-71ISS
UniRef100_Q09WE7UniRef Annotation by Michelle Graham. Most informative UniRef hit: UDP-sugar pyrophosphorylase 1 n=1 Tax=Glycine max RepID=USP1_SOYBN SoyBaseE_val: 1.00E-68ISS

Expression Patterns of Glyma06g37151
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g37151 not represented in the dataset
Glyma06g37151 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g37151 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g242400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g37151
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g37151
>Glyma06g37151.1   sequence type=CDS   gene model=Glyma06g37151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCTCCCTCGACGACAACTTCAACCTTCTCTCTCCTGAACAGCAAGAGCTGGTGAAGGTGCTACTGGATAACGGCCAAGAGCACCTGTTTCGCGATTGGCCAGCTCCCGGCGTCGATGATAACCACAAGAAAGCGTTCTTTGACCAGTTGACTCAACTCGATTCGAGTTACCCTGGTGGTCTGGAATCATACATCAAAAACGCTAAACGGCTCTTGGCCGATTCTAAGGCTGGCATAAACCCTTTCGACGGCTTTACACCTTCCGTTCCAACGGGTGAGACTTTGGCATTTGGTGATGAGAGCTACATCAAATTTGAGGAAGCAGGTGTACTTGAAGCTCGACTGCTTTTGTTCTTGTTGCCGGTGGTCTTGGCAAGCGTTTAG
Predicted protein sequences of Glyma06g37151
>Glyma06g37151.1   sequence type=predicted peptide   gene model=Glyma06g37151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSLDDNFNLLSPEQQELVKVLLDNGQEHLFRDWPAPGVDDNHKKAFFDQLTQLDSSYPGGLESYIKNAKRLLADSKAGINPFDGFTPSVPTGETLAFGDESYIKFEEAGVLEARLLLFLLPVVLASV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo