Report for Sequence Feature Glyma06g37100
Feature Type: gene_model
Chromosome: Gm06
Start: 39491007
stop: 39494203
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g37100
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G26640 AT
Annotation by Michelle Graham. TAIR10: WRKY family transcription factor family protein | chr4:13437298-13439774 REVERSE LENGTH=485
SoyBase E_val: 2.00E-60 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009611 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to wounding
SoyBase N/A ISS
GO:0009616 GO-bp
Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing
SoyBase N/A ISS
GO:0009961 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to 1-Aminocyclopropane-1-carboxylic Acid
SoyBase N/A ISS
GO:0010050 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative phase change
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
PF03106 PFAM
WRKY DNA -binding domain
JGI ISS
UniRef100_B0LUR9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Glycine max RepID=B0LUR9_SOYBN
SoyBase E_val: 2.00E-117 ISS
UniRef100_UPI000233A446 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233A446 related cluster n=1 Tax=unknown RepID=UPI000233A446
SoyBase E_val: 3.00E-125 ISS
Proteins Associated with Glyma06g37100
Locus Gene Symbol Protein Name
WRKY104 WRKY Transcription Factor
Expression Patterns of Glyma06g37100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma06g37100 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g242200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g37100
Coding sequences of Glyma06g37100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g37100.1 sequence type=CDS gene model=Glyma06g37100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ACTTTGAGTGAGGTTGACATATTGGATGATGGGTACTGCTGGCGTAAGTATGGCCAAAAGGTTGTGAGAGGCAATCCTAACCCAAGGAGCTATTACAAATGCACAAATGCTGGTTGCCCTGTCAGAAAACATGTGGAGAGGGCATCTCATGATCCAAAAGCAGTGATAACCACATATGAGGGTAAACACAATCATGATGTACCAGCTGCAAGGAATAGCAGCCATGACATGGCAGTACCAGCAGTTGCAGCAGGTGGACAGACAAGAACTAAGTTAGAAGAAAGTGATACCATTAGCCTTGACCTTGGAATGGGAATTACCTCAGCTGCTGAACATAGGTCAAATGGGCAAGGGAAAATGCTGCATTCAGATTCCAACTTGAAGTTTGTTCATACTACCTCAACTCCAGTATACTTTGGTGTTCTAAATAACAGCTCAAATTCCTATGGTTCTAGAGACAATAGGAGTGATGGTCCATCTTTAAACCGTTCCTCATATCCATGCCCACAGAGCATGGGAAGAATACTAATG
Predicted protein sequences of Glyma06g37100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g37100.1 sequence type=predicted peptide gene model=Glyma06g37100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
TLSEVDILDDGYCWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHDVPAARNSSHDMAVPAVAAGGQTRTKLEESDTISLDLGMGITSAAEHRSNGQGKMLHSDSNLKFVHTTSTPVYFGVLNNSSNSYGSRDNRSDGPSLNRSSYPCPQSMGRILM