SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g37100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g37100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g37100

Feature Type:gene_model
Chromosome:Gm06
Start:39491007
stop:39494203
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26640AT Annotation by Michelle Graham. TAIR10: WRKY family transcription factor family protein | chr4:13437298-13439774 REVERSE LENGTH=485 SoyBaseE_val: 2.00E-60ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009961GO-bp Annotation by Michelle Graham. GO Biological Process: response to 1-Aminocyclopropane-1-carboxylic Acid SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_B0LUR9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Glycine max RepID=B0LUR9_SOYBN SoyBaseE_val: 2.00E-117ISS
UniRef100_UPI000233A446UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A446 related cluster n=1 Tax=unknown RepID=UPI000233A446 SoyBaseE_val: 3.00E-125ISS

LocusGene SymbolProtein Name
WRKY104 WRKY Transcription Factor

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g37100 not represented in the dataset

Glyma06g37100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g242200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g37100.1   sequence type=CDS   gene model=Glyma06g37100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACTTTGAGTGAGGTTGACATATTGGATGATGGGTACTGCTGGCGTAAGTATGGCCAAAAGGTTGTGAGAGGCAATCCTAACCCAAGGAGCTATTACAAATGCACAAATGCTGGTTGCCCTGTCAGAAAACATGTGGAGAGGGCATCTCATGATCCAAAAGCAGTGATAACCACATATGAGGGTAAACACAATCATGATGTACCAGCTGCAAGGAATAGCAGCCATGACATGGCAGTACCAGCAGTTGCAGCAGGTGGACAGACAAGAACTAAGTTAGAAGAAAGTGATACCATTAGCCTTGACCTTGGAATGGGAATTACCTCAGCTGCTGAACATAGGTCAAATGGGCAAGGGAAAATGCTGCATTCAGATTCCAACTTGAAGTTTGTTCATACTACCTCAACTCCAGTATACTTTGGTGTTCTAAATAACAGCTCAAATTCCTATGGTTCTAGAGACAATAGGAGTGATGGTCCATCTTTAAACCGTTCCTCATATCCATGCCCACAGAGCATGGGAAGAATACTAATG

>Glyma06g37100.1   sequence type=predicted peptide   gene model=Glyma06g37100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TLSEVDILDDGYCWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHDVPAARNSSHDMAVPAVAAGGQTRTKLEESDTISLDLGMGITSAAEHRSNGQGKMLHSDSNLKFVHTTSTPVYFGVLNNSSNSYGSRDNRSDGPSLNRSSYPCPQSMGRILM







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo