SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g36991

Feature Type:gene_model
Chromosome:Gm06
Start:39341884
stop:39342479
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53090AT Annotation by Michelle Graham. TAIR10: SPA1-related 4 | chr1:19783748-19786690 FORWARD LENGTH=794 SoyBaseE_val: 1.00E-41ISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0010100GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of photomorphogenesis SoyBaseN/AISS
GO:0048608GO-bp Annotation by Michelle Graham. GO Biological Process: reproductive structure development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005834GO-cc Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PTHR22847Panther WD40 REPEAT PROTEIN JGI ISS
PTHR22847:SF121Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9T5N2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin ligase protein cop1, putative n=1 Tax=Ricinus communis RepID=B9T5N2_RICCO SoyBaseE_val: 1.00E-41ISS
UniRef100_UPI000233A445UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A445 related cluster n=1 Tax=unknown RepID=UPI000233A445 SoyBaseE_val: 3.00E-48ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g36991 not represented in the dataset

Glyma06g36991 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g241900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g36991.1   sequence type=CDS   gene model=Glyma06g36991   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACTTCGTGGGGTTGTCTGTATCTGATGGTTACATTGCTACTGGTTCAGAGACAAACGAGGTGTTCATATACCACAAGGCTTTTCCCATGCCAGCATTATCTTTCAAATTTTACAGTAGTGACCCTCTTTCTGGTAATGAAGAGGATGATTCTGCACAGTTCATCACTTCTGTTTGTTGGCGCGGTCAGTCGTCCACCTTAGTTGCTGCAAATTCCACAGGAAATGTCAAAATTCTGGAGATGACTTAA

>Glyma06g36991.1   sequence type=predicted peptide   gene model=Glyma06g36991   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NFVGLSVSDGYIATGSETNEVFIYHKAFPMPALSFKFYSSDPLSGNEEDDSAQFITSVCWRGQSSTLVAANSTGNVKILEMT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo