|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G15900 | AT | Annotation by Michelle Graham. TAIR10: pleiotropic regulatory locus 1 | chr4:9023775-9027443 FORWARD LENGTH=486 | SoyBase | E_val: 6.00E-28 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0006396 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA processing | SoyBase | N/A | ISS |
| GO:0006508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteolysis | SoyBase | N/A | ISS |
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS |
| GO:0009755 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009870 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-dependent | SoyBase | N/A | ISS |
| GO:0009880 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0010072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification | SoyBase | N/A | ISS |
| GO:0010154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fruit development | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010204 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-independent | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010431 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed maturation | SoyBase | N/A | ISS |
| GO:0010564 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0022402 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell cycle process | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0043687 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-translational protein modification | SoyBase | N/A | ISS |
| GO:0045595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation | SoyBase | N/A | ISS |
| GO:0045892 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0048364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root development | SoyBase | N/A | ISS |
| GO:0048366 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf development | SoyBase | N/A | ISS |
| GO:0048825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cotyledon development | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0051301 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell division | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0080008 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR19923 | Panther | WD40 REPEAT PROTEINPRL1/PRL2-RELATED | JGI | ISS | |
| PF00400 | PFAM | WD domain, G-beta repeat | JGI | ISS | |
| UniRef100_E4MVI9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-04-F10 n=1 Tax=Eutrema halophilum RepID=E4MVI9_THEHA | SoyBase | E_val: 3.00E-25 | ISS |
| UniRef100_UPI00003DB084 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI00003DB084 related cluster n=1 Tax=unknown RepID=UPI00003DB084 | SoyBase | E_val: 1.00E-27 | ISS |
|
Glyma06g36893 not represented in the dataset |
Glyma06g36893 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g241500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g36893.1 sequence type=CDS gene model=Glyma06g36893 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAACCTCCACGGAGCTGTCTTGCTTGGCCAGTTTGACAGTGAGCTTGCGGTAGTCGGAAGGGTGACGGCCGTCGACTCGGAGGTCATCAGCGGTCACTTGGGATGGGTGAGATCTGTTGCAGTTGATCCCAGTAACATTAGTTGGTTATTTTGCTCGAGTTGTTCCTTTGGACAGTTATGGGACTTGGCAAGTGGAGTATTGAAGCTCACATTAATAGTCCACATTGAACAAGTTAGAGGTCTTGCTGTTAGCAACAAACATACTTACATGTTCTCTGCTGGTGACCATAAACAAAATCCCCAAGTCGTTACGGGTTCTCATGACACTACCATCAAGATGTGGGACCTTAGATATGGTAAAACAATGCCAACTCTTACAAACCATAAAAAATCTATATACAATTTATTAGTAGAACATTTTAATTAA
>Glyma06g36893.1 sequence type=predicted peptide gene model=Glyma06g36893 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNLHGAVLLGQFDSELAVVGRVTAVDSEVISGHLGWVRSVAVDPSNISWLFCSSCSFGQLWDLASGVLKLTLIVHIEQVRGLAVSNKHTYMFSAGDHKQNPQVVTGSHDTTIKMWDLRYGKTMPTLTNHKKSIYNLLVEHFN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||